(data stored in ACNUC7421 zone)

EMBL: CP001389.PE221

CP001389.PE221       Location/Qualifiers
FT   CDS             257334..257765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02260"
FT                   /product="putative low molecular weight tyrosine
FT                   phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24025"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX4"
FT                   /protein_id="ACP24025.1"
FT                   /translation="MPRSILFMCGMNAIRSPMAEALAKAALPKGTYVASAGVRHGERDP
FT                   FVDVVLDEVGLTIGRHQPHTLDELEDDYFDVIVTLAPEAHHKALELTRSMAVDVVYWPT
FT                   PDPTVATGTRDQIVGAYRAVRDHLAGLIASRLAGRGQVG"
     MPRSILFMCG MNAIRSPMAE ALAKAALPKG TYVASAGVRH GERDPFVDVV LDEVGLTIGR        60
     HQPHTLDELE DDYFDVIVTL APEAHHKALE LTRSMAVDVV YWPTPDPTVA TGTRDQIVGA       120
     YRAVRDHLAG LIASRLAGRG QVG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page