(data stored in ACNUC7421 zone)

EMBL: CP001389.PE223

CP001389.PE223       Location/Qualifiers
FT   CDS             258204..258824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02280"
FT                   /product="predicted septum formation protein, Maf-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24027"
FT                   /db_xref="GOA:C3MFX6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX6"
FT                   /protein_id="ACP24027.1"
FT                   /translation="MTVTQKLILASGSPRRVELLAQAGIEPARLLPMDLDETPKRAEHP
FT                   RSLARRLSAEKAKAALAAVKGEPSWDGSYILAADTVVCVGRRILPKPELVSEASSALHL
FT                   LSGRSHRVYTGICLVTPDRTIRQKVVDTKVRFKRLSGLDIETYLASGQWRGKAGGYGIQ
FT                   GIAGSFVVKLVGSYTNVVGLPLYETVNLLIGEGYDVHGRWLEG"
     MTVTQKLILA SGSPRRVELL AQAGIEPARL LPMDLDETPK RAEHPRSLAR RLSAEKAKAA        60
     LAAVKGEPSW DGSYILAADT VVCVGRRILP KPELVSEASS ALHLLSGRSH RVYTGICLVT       120
     PDRTIRQKVV DTKVRFKRLS GLDIETYLAS GQWRGKAGGY GIQGIAGSFV VKLVGSYTNV       180
     VGLPLYETVN LLIGEGYDVH GRWLEG                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page