(data stored in ACNUC7421 zone)

EMBL: CP001389.PE224

CP001389.PE224       Location/Qualifiers
FT   CDS             258831..259040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02290"
FT                   /product="hypothetical protein contains zinc-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24028"
FT                   /db_xref="GOA:C3MFX7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFX7"
FT                   /protein_id="ACP24028.1"
FT                   /translation="MSGEGKKHGSNVEPLRPTRPCPECGRPSVRERYPFCSERCRNVDL
FT                   NRWLSGSYAIPVADDESKADDEDR"
     MSGEGKKHGS NVEPLRPTRP CPECGRPSVR ERYPFCSERC RNVDLNRWLS GSYAIPVADD        60
     ESKADDEDR                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page