(data stored in ACNUC7421 zone)

EMBL: CP001389.PE225

CP001389.PE225       Location/Qualifiers
FT   CDS             complement(259599..260963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02310"
FT                   /product="putative transmembrane response regulator protein
FT                   with GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24029"
FT                   /db_xref="GOA:C3MFX8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX8"
FT                   /protein_id="ACP24029.1"
FT                   /translation="MGPLTYETAFERDPPPGAHLASGSCSTKWANMDVQESAISTDRVS
FT                   PSTKLQVQDPAVLSEVERLLAGRTRDIRLKGKLRLLFQERSWPRTAKIVRAWMTWVVVL
FT                   DVVTLALNAILLPKAIALSMLLPACLLPPAAMATAFVWQRPRAQWLQRISIIAGLFLIF
FT                   LSVALVGVSAGGEFYERHLNIMLFVAITAIIIFGVPLNWTVTVASLALGLYLVFQLQNP
FT                   SLEKGSAVAATLFFASGIIATVVARRTMTILAQKTFLLELRDRSRVAELADANARLERL
FT                   ARTDPLTGISNRRWMMETLDHLWSDGMERRGCAMLMCDIDEFKNLNDRLGHAEGDRCLV
FT                   KVAGIIQSSVRRNRDHVARYGGEEFLIVLPGVDEREAIAMGERIRGSVEAASLPNPASR
FT                   VLPYVTLSIGVAAQRPGDEIIPPERLQNQADAALYLAKQAGRNRVVLHKAGALGT"
     MGPLTYETAF ERDPPPGAHL ASGSCSTKWA NMDVQESAIS TDRVSPSTKL QVQDPAVLSE        60
     VERLLAGRTR DIRLKGKLRL LFQERSWPRT AKIVRAWMTW VVVLDVVTLA LNAILLPKAI       120
     ALSMLLPACL LPPAAMATAF VWQRPRAQWL QRISIIAGLF LIFLSVALVG VSAGGEFYER       180
     HLNIMLFVAI TAIIIFGVPL NWTVTVASLA LGLYLVFQLQ NPSLEKGSAV AATLFFASGI       240
     IATVVARRTM TILAQKTFLL ELRDRSRVAE LADANARLER LARTDPLTGI SNRRWMMETL       300
     DHLWSDGMER RGCAMLMCDI DEFKNLNDRL GHAEGDRCLV KVAGIIQSSV RRNRDHVARY       360
     GGEEFLIVLP GVDEREAIAM GERIRGSVEA ASLPNPASRV LPYVTLSIGV AAQRPGDEII       420
     PPERLQNQAD AALYLAKQAG RNRVVLHKAG ALGT                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page