(data stored in ACNUC7421 zone)

EMBL: CP001389.PE226

CP001389.PE226       Location/Qualifiers
FT   CDS             complement(261079..266142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02320"
FT                   /product="conserved hypothetical protein, contains ice
FT                   nucleation protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24030"
FT                   /db_xref="InterPro:IPR026664"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX9"
FT                   /protein_id="ACP24030.1"
FT                   /translation="MTSIISSLSVTQIKNLSTTAVASLTTEDVAAMTTAQVKALSSTQI
FT                   AALDTEDVAIFSTAQLSAIAATSVAGISLDQLAAIDSAKIASLATSQVAALSSAQIDGL
FT                   SSDQAEALTTSQVAALGSAQLAAFSSEDITTFSTAEIAAISVTALAGLSTDNLAALSTD
FT                   QAAALKTTQVAALKTTQVAALTTDQIGALSSSQIAVLSSTQVKALSTDNIAALSTDQVA
FT                   ALNSKTVAALTSAQIDALSSDQAEALTTAQVASLTSTQVAALASEDIATFSTADIAAIT
FT                   VTALTGLSTDNVAALSTDQAAALKTTQVAALKTAQVAALTSDQVVALTSSQVGVLSSTQ
FT                   ISALSTDNVAALTTDQVAALNSKTVAALSSAQIGALSSDQVEALSAVQIAALDSADIAA
FT                   LASEDIATFSTSEIAAITATALSGLSTDNVAALSTDQTAALKTSQIAALKTAQIAALTS
FT                   DQVVALTSSQVGSLSSTQISALTTDNVAALSTDQVAALNSKTVAALSSTQIGALTSDQA
FT                   EALTTAQVAALTSTQIAAFASEDIAAFSTADIAAITVTALGGLSTDNVAALSTDQAAAL
FT                   KTTQVAALKSTQIAALTSDQVLALTSSQVGALTSTQVKALSTDNVAALSTDQVAALNSK
FT                   TVAALSSAQVDALSSDQAEALTTAQVASLGSTQIAAFASEDIAGFSTADIAAITVTALT
FT                   GLSTDNVAALSTDQAAALKTTQVAALKTAQIAALTSDQVVALTSSQVGALTSSQVSAIS
FT                   TDNIAALSTDQVAALNSKTVAALTTAQIEALSSTQVEALTSVLVGALSSTQLSVLASED
FT                   IAAFSTADIAAITVTALGGLSTDNVAALSTDQAAALKTTQVAALKSTQIAALTSDQIEA
FT                   LSTAQIGALTSTQASAISTDSLAALSTDQVAALNTKTLASLSTVQIDAMSSDQLEALTS
FT                   AQVAALTMAQLGALASEDVATFSTADIAAITVAALAGLSTDNVAALSTDQAAALKTTQI
FT                   AALKTAQIAALTSDQVVALTSSQVGALSSTQISALSTDNVAALSTDQVAALNSKTVAAL
FT                   SSVQIDALSSDQAEALTTAQVAALGSTQLAAFASEDLATFSTADIAAITVTALVGLSTD
FT                   NLAALSTDQAAALKTTQVAALSTAQVGALTSDQVVALTSSQVGALTSTQVKALSTDNVA
FT                   ALSTDQVAALNSKSVAALTSVQIEALTSDQAEALTTAQVASLTSTQVAALASEDIATFS
FT                   TADIAAITVTALAGLSTDNVAALSTDQAAALKTTQVVALKTAQIAALTSDQVVALTSSQ
FT                   VGALTSTQISALSTDNVAALSTDQVAALNSKTVAALSSTQIEALSSDQAEALTSAQIAA
FT                   LDSADIAALASEDIATFSTSEIAAITATALLGLSTDNVAALSTDQAAALKTAQIAALKT
FT                   AQIAALTSDQVAALTTSQVGTLSSTQIAVISTDNIAALTTDQVAALNSKTVAALTSTQI
FT                   EALSSDQAEALTTAQVAALGSAQVAALASEDLATFSTADIAAITVTALTGLSTDNLAEL
FT                   STDQAAALKTTQVAALSTAQIGALTSDQVAALSSAQIGALTSTQLTALSTDNVAALTTD
FT                   QVAALSSKVIGALSSDQIDALSTDQVEALTSAQVAALDSADIAALSTDDIATFSTADIA
FT                   AISTTALAGLSTDDIMSLSSDQLVAVTTTQVEALDDSQVEAIIAAYQAI"
     MTSIISSLSV TQIKNLSTTA VASLTTEDVA AMTTAQVKAL SSTQIAALDT EDVAIFSTAQ        60
     LSAIAATSVA GISLDQLAAI DSAKIASLAT SQVAALSSAQ IDGLSSDQAE ALTTSQVAAL       120
     GSAQLAAFSS EDITTFSTAE IAAISVTALA GLSTDNLAAL STDQAAALKT TQVAALKTTQ       180
     VAALTTDQIG ALSSSQIAVL SSTQVKALST DNIAALSTDQ VAALNSKTVA ALTSAQIDAL       240
     SSDQAEALTT AQVASLTSTQ VAALASEDIA TFSTADIAAI TVTALTGLST DNVAALSTDQ       300
     AAALKTTQVA ALKTAQVAAL TSDQVVALTS SQVGVLSSTQ ISALSTDNVA ALTTDQVAAL       360
     NSKTVAALSS AQIGALSSDQ VEALSAVQIA ALDSADIAAL ASEDIATFST SEIAAITATA       420
     LSGLSTDNVA ALSTDQTAAL KTSQIAALKT AQIAALTSDQ VVALTSSQVG SLSSTQISAL       480
     TTDNVAALST DQVAALNSKT VAALSSTQIG ALTSDQAEAL TTAQVAALTS TQIAAFASED       540
     IAAFSTADIA AITVTALGGL STDNVAALST DQAAALKTTQ VAALKSTQIA ALTSDQVLAL       600
     TSSQVGALTS TQVKALSTDN VAALSTDQVA ALNSKTVAAL SSAQVDALSS DQAEALTTAQ       660
     VASLGSTQIA AFASEDIAGF STADIAAITV TALTGLSTDN VAALSTDQAA ALKTTQVAAL       720
     KTAQIAALTS DQVVALTSSQ VGALTSSQVS AISTDNIAAL STDQVAALNS KTVAALTTAQ       780
     IEALSSTQVE ALTSVLVGAL SSTQLSVLAS EDIAAFSTAD IAAITVTALG GLSTDNVAAL       840
     STDQAAALKT TQVAALKSTQ IAALTSDQIE ALSTAQIGAL TSTQASAIST DSLAALSTDQ       900
     VAALNTKTLA SLSTVQIDAM SSDQLEALTS AQVAALTMAQ LGALASEDVA TFSTADIAAI       960
     TVAALAGLST DNVAALSTDQ AAALKTTQIA ALKTAQIAAL TSDQVVALTS SQVGALSSTQ      1020
     ISALSTDNVA ALSTDQVAAL NSKTVAALSS VQIDALSSDQ AEALTTAQVA ALGSTQLAAF      1080
     ASEDLATFST ADIAAITVTA LVGLSTDNLA ALSTDQAAAL KTTQVAALST AQVGALTSDQ      1140
     VVALTSSQVG ALTSTQVKAL STDNVAALST DQVAALNSKS VAALTSVQIE ALTSDQAEAL      1200
     TTAQVASLTS TQVAALASED IATFSTADIA AITVTALAGL STDNVAALST DQAAALKTTQ      1260
     VVALKTAQIA ALTSDQVVAL TSSQVGALTS TQISALSTDN VAALSTDQVA ALNSKTVAAL      1320
     SSTQIEALSS DQAEALTSAQ IAALDSADIA ALASEDIATF STSEIAAITA TALLGLSTDN      1380
     VAALSTDQAA ALKTAQIAAL KTAQIAALTS DQVAALTTSQ VGTLSSTQIA VISTDNIAAL      1440
     TTDQVAALNS KTVAALTSTQ IEALSSDQAE ALTTAQVAAL GSAQVAALAS EDLATFSTAD      1500
     IAAITVTALT GLSTDNLAEL STDQAAALKT TQVAALSTAQ IGALTSDQVA ALSSAQIGAL      1560
     TSTQLTALST DNVAALTTDQ VAALSSKVIG ALSSDQIDAL STDQVEALTS AQVAALDSAD      1620
     IAALSTDDIA TFSTADIAAI STTALAGLST DDIMSLSSDQ LVAVTTTQVE ALDDSQVEAI      1680
     IAAYQAI                                                                1687
//

If you have problems or comments...

PBIL Back to PBIL home page