(data stored in ACNUC7421 zone)

EMBL: CP001389.PE227

CP001389.PE227       Location/Qualifiers
FT   CDS             266825..268882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02330"
FT                   /product="conserved hypothetical protein contains
FT                   tetratricopeptide protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24031"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY0"
FT                   /protein_id="ACP24031.1"
FT                   /translation="MTIYTHLASDPASPLAGFLERARQQRLPLTELFQFAESFNAAGQR
FT                   EQAAELYKSWIAYNDSNPLLHLVYFNYSVTLRQMGDLAGSIHALRACLKFEPRFGQGHI
FT                   NLGRALEDAGLTGQAIQQWQVYAEATSEITPERAAHRLMVLQHMGRVLENAGLMEEAES
FT                   TLWKAIELRPDKTEAGQHWTSLRQRQCKWPTLAPSEHVSARQLLDALSPLTLACYADDP
FT                   VFQLAKAYRYCKSLVGRPDLSGFPKLQPRQKSGTGQRLRVGYVSSDLRDHAVGFALSEV
FT                   FETHDKSSVEIYAYYCGEARTGDATQTRMMSTIDCWRDISAISDSDAAKQIIADEIDIL
FT                   VDVNGYTKHARTRIFAYRPAPVIVSFCGYPGTMGSPFHQYVIADEQIIPPENEIYYSEK
FT                   VLRIPCNQPVDRKRQIAPRPSRAEAGLPEDGFIFACFNGAQKITAACFDRWMAILAATP
FT                   GSCLWLLGGGEDVDQRLKQAAQQRGVAPERLIFASKAPNPKHLARIGLADLFLDTFPYG
FT                   AHSTAGDALTMGLPVLTFPGNGFASRFCSSIVAAAGVPELICEGPDDFVRKAIGFAKDR
FT                   QSLASVREALESRRDASVLRDIPALVRRLEELLWQMQGECERGETPVPDLSNLDIYYEV
FT                   GAEIMKENVEFVDSAAYRQRYVEKLAEWHAFSPIPFDSRLWTAATAGARR"
     MTIYTHLASD PASPLAGFLE RARQQRLPLT ELFQFAESFN AAGQREQAAE LYKSWIAYND        60
     SNPLLHLVYF NYSVTLRQMG DLAGSIHALR ACLKFEPRFG QGHINLGRAL EDAGLTGQAI       120
     QQWQVYAEAT SEITPERAAH RLMVLQHMGR VLENAGLMEE AESTLWKAIE LRPDKTEAGQ       180
     HWTSLRQRQC KWPTLAPSEH VSARQLLDAL SPLTLACYAD DPVFQLAKAY RYCKSLVGRP       240
     DLSGFPKLQP RQKSGTGQRL RVGYVSSDLR DHAVGFALSE VFETHDKSSV EIYAYYCGEA       300
     RTGDATQTRM MSTIDCWRDI SAISDSDAAK QIIADEIDIL VDVNGYTKHA RTRIFAYRPA       360
     PVIVSFCGYP GTMGSPFHQY VIADEQIIPP ENEIYYSEKV LRIPCNQPVD RKRQIAPRPS       420
     RAEAGLPEDG FIFACFNGAQ KITAACFDRW MAILAATPGS CLWLLGGGED VDQRLKQAAQ       480
     QRGVAPERLI FASKAPNPKH LARIGLADLF LDTFPYGAHS TAGDALTMGL PVLTFPGNGF       540
     ASRFCSSIVA AAGVPELICE GPDDFVRKAI GFAKDRQSLA SVREALESRR DASVLRDIPA       600
     LVRRLEELLW QMQGECERGE TPVPDLSNLD IYYEVGAEIM KENVEFVDSA AYRQRYVEKL       660
     AEWHAFSPIP FDSRLWTAAT AGARR                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page