(data stored in ACNUC7421 zone)

EMBL: CP001389.PE23

CP001389.PE23        Location/Qualifiers
FT   CDS             20500..20841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23827"
FT                   /db_xref="GOA:C3MEK4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK4"
FT                   /protein_id="ACP23827.1"
FT                   /translation="MFKKIVNIVVLVPLGVILIALSVANRQTVTLALNPFDTADSVLSV
FT                   SAPFFLFLFLAVVVGLVLGAAAVWLSQGKYRRRARSEAHEALKWHREAEKHRSEAERLS
FT                   QVNLPAPQN"
     MFKKIVNIVV LVPLGVILIA LSVANRQTVT LALNPFDTAD SVLSVSAPFF LFLFLAVVVG        60
     LVLGAAAVWL SQGKYRRRAR SEAHEALKWH REAEKHRSEA ERLSQVNLPA PQN              113
//

If you have problems or comments...

PBIL Back to PBIL home page