(data stored in ACNUC7421 zone)

EMBL: CP001389.PE230

CP001389.PE230       Location/Qualifiers
FT   CDS             271818..278894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02360"
FT                   /product="conserved hypothetical protein, contains ice
FT                   nucleation protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24034"
FT                   /db_xref="InterPro:IPR026664"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY3"
FT                   /protein_id="ACP24034.1"
FT                   /translation="MTSIISSLSPTLIKSYSTAAVAAWTTEDVASLTTKQISAMSSAQI
FT                   AALDTEDVDVLSSRQLGAISPSAIVGLTLEQLAVLDQSDIESFGTSQVAALTTKQIDGL
FT                   SAEQAEALSSTQVGALSALQLSVLTEEDLESFSTADIAAIGAKAITGLPADVVASLSTD
FT                   QIAGLSTRAVAALSTAQIAALSTDQLAALTTAQVTALKASQIEALGTDDIATLSTQQMA
FT                   ALSASAISGLSTKQIAALSVDQIEALTVSQVKALTAAQLGSLETDGIAAFSTAEIAAIS
FT                   RAVWGLTTEAFAALSTAQVAALNTAAVASLTTAQMAALSADQAEAMSVLQVKALNSRQL
FT                   AALGTEGIATFSTGEIAAIANLAIKGVSTDAIAALSTAQVAALSTSAISGLTTAQSEAF
FT                   SSDQAAVLSAAQLRTLSSAQVAALGTDNIEALSTDQIAALNTKGVMGLTTDQVAALSTD
FT                   QVEALSVTQVKALNALQLEALGTDGLAMFSTGEIAALSNKAILGVDAEVIASLSTDQIA
FT                   ALSTSAVASLTSAQLAALSTDQAEALSVSQVKVLSSAQLAALGEDGIATFSTAEIAAIT
FT                   SKAVPGVSDDAITALSTAQIAALSTTAVASLTTAQVAALSTDQTAALSTAQLKALSSTQ
FT                   LAALSTDNVAALTTVQVAALGTKAVAGLTADQVEALSSDQVAALSTQQVAALGSEQLAV
FT                   LSAEDIAAFSTADIAAISSSAIAGLSADLMEALTTAQIVALSTKGVARLSTDQIDALSS
FT                   DQLAALSSVQVAVLSSAQLSALEAEDIATFSTADIAAIGSKAISGLSEDVVAALTSTQI
FT                   AALSTGGVAGLSTDQMATLSSDQVVALSTKQIAALKSTQVAALSTETVAALSSDLIAAL
FT                   STAGINELTTDQVEALSTDQIVALSTKQVAALSSAQIAALDTSDIAVFSTEQIAVLTTA
FT                   AISGLSTRQIDALSTEQMEALTAVQVGALSSAQLGALGTEDIAVFSTKDIAAISAAAMA
FT                   GLSTAVVAALSTDEIALLSTAGIAGLSSAQLNVLSTSQLAALSTKQAAALTSAQVAALG
FT                   TSGLAALSTDQISVLSAAAIAGLTTKQLVALGAGQMEALTSTQIGALSATQLGVLGAED
FT                   IAAFSTKDIAAIRSTAISSLSTAAIAALSTDQIAAVSAAGIAGLSSAQVNALSATQLAA
FT                   LSTKQVAALTSAQVTALGSSDITALSADQIEALGSAAVAGLTTRQLAALSTDQLEALTA
FT                   VQTGALSSVQLGALGAEDVAVFSTKDIAAIGSSAIAGLSTAAIASLSTEQIGALSAAAV
FT                   SALTTKQIAVLSSGQIAALSTEQLGGLTSQQIAALDADDIKALSIDDIAALGADLVSGL
FT                   STDVIAAFSTDQIAALSTAAVAALSTKQVDALSTGQLAVLTTAQIGALTSRQVDALSTD
FT                   DVATLTTDQIAALSAAGVVGLSTADIAILSSGQVDALTTSQIAALGSKQIAALGTDDIA
FT                   GFSVAEIAALSSSAVAGLSTETIAALSAEQIAALSTAGIAGLSTAQVNALSTDQIGALS
FT                   TEQVAALSSKQVAALGTDDMAALSADQIAALGTTGIAVLSSAQIDALSAEQLEALTSVQ
FT                   VAALSSTQIAALSTDDLAAFSTADIAAISSAAVAGLSTDTLAALSADQIAALSAAGIAD
FT                   LSTAQINALSADQLEALSTDQIAALSSKQVAALGTDDIAALSTEQIAALSTAGVAALST
FT                   AQIQALSADQLEALTPSQVAVMSSTQIAALSTADLESFSSADIGAIGSSAVAGLSTDTL
FT                   AALSADQIAALSATGVAGLSTVQILALSTDQIEALSTDQIAALSSKQLAVLGTDDIAVL
FT                   STDQIAALGTAAIAGLSTTQINALNADQLEAMTSGQVAVMSSTQIAALSTGDLESFSTA
FT                   DIAAISSRAVAGLSTDTIAALSADQIAALGTGGVAGLSTAQINALNTDQVEALTSLQIG
FT                   ALTSQQIAVLGTDDLETFSTDEIAAISSTAVLGLSTDTIAALSVDQVAALSSAGISGLS
FT                   TAQINALSTDQIEALSTAQIGGLGSKQVAALGTADLAVLSTSQIAALSTAGIAGLSSEQ
FT                   VGALSDEQVEALSTVQIAAMSSDALSGLSTDDLEGFSVEELAAISSSAIRGLSTDFIAG
FT                   LSTAEIAALGTASLAGLSSAQVGAMSAEQIDTLSTLQIAALSADGLAGLTTEDLGTFTT
FT                   GELVAISAAAIKGLSTTFVAALSTAEIAALTASQVGSLSYNQVAAMSTTQIATLSTAQL
FT                   SALNAIQAAALGTDDIAQLSTDDIVALGTSAISGLTTRVVAALTTDQAEALTAVQVGAM
FT                   TSAQVAALETEDLATFSAEDVASFSSYGVAGLSTEDIGNLSSTQLNALMDSQMDALDSD
FT                   QIAAVIAAYLGM"
     MTSIISSLSP TLIKSYSTAA VAAWTTEDVA SLTTKQISAM SSAQIAALDT EDVDVLSSRQ        60
     LGAISPSAIV GLTLEQLAVL DQSDIESFGT SQVAALTTKQ IDGLSAEQAE ALSSTQVGAL       120
     SALQLSVLTE EDLESFSTAD IAAIGAKAIT GLPADVVASL STDQIAGLST RAVAALSTAQ       180
     IAALSTDQLA ALTTAQVTAL KASQIEALGT DDIATLSTQQ MAALSASAIS GLSTKQIAAL       240
     SVDQIEALTV SQVKALTAAQ LGSLETDGIA AFSTAEIAAI SRAVWGLTTE AFAALSTAQV       300
     AALNTAAVAS LTTAQMAALS ADQAEAMSVL QVKALNSRQL AALGTEGIAT FSTGEIAAIA       360
     NLAIKGVSTD AIAALSTAQV AALSTSAISG LTTAQSEAFS SDQAAVLSAA QLRTLSSAQV       420
     AALGTDNIEA LSTDQIAALN TKGVMGLTTD QVAALSTDQV EALSVTQVKA LNALQLEALG       480
     TDGLAMFSTG EIAALSNKAI LGVDAEVIAS LSTDQIAALS TSAVASLTSA QLAALSTDQA       540
     EALSVSQVKV LSSAQLAALG EDGIATFSTA EIAAITSKAV PGVSDDAITA LSTAQIAALS       600
     TTAVASLTTA QVAALSTDQT AALSTAQLKA LSSTQLAALS TDNVAALTTV QVAALGTKAV       660
     AGLTADQVEA LSSDQVAALS TQQVAALGSE QLAVLSAEDI AAFSTADIAA ISSSAIAGLS       720
     ADLMEALTTA QIVALSTKGV ARLSTDQIDA LSSDQLAALS SVQVAVLSSA QLSALEAEDI       780
     ATFSTADIAA IGSKAISGLS EDVVAALTST QIAALSTGGV AGLSTDQMAT LSSDQVVALS       840
     TKQIAALKST QVAALSTETV AALSSDLIAA LSTAGINELT TDQVEALSTD QIVALSTKQV       900
     AALSSAQIAA LDTSDIAVFS TEQIAVLTTA AISGLSTRQI DALSTEQMEA LTAVQVGALS       960
     SAQLGALGTE DIAVFSTKDI AAISAAAMAG LSTAVVAALS TDEIALLSTA GIAGLSSAQL      1020
     NVLSTSQLAA LSTKQAAALT SAQVAALGTS GLAALSTDQI SVLSAAAIAG LTTKQLVALG      1080
     AGQMEALTST QIGALSATQL GVLGAEDIAA FSTKDIAAIR STAISSLSTA AIAALSTDQI      1140
     AAVSAAGIAG LSSAQVNALS ATQLAALSTK QVAALTSAQV TALGSSDITA LSADQIEALG      1200
     SAAVAGLTTR QLAALSTDQL EALTAVQTGA LSSVQLGALG AEDVAVFSTK DIAAIGSSAI      1260
     AGLSTAAIAS LSTEQIGALS AAAVSALTTK QIAVLSSGQI AALSTEQLGG LTSQQIAALD      1320
     ADDIKALSID DIAALGADLV SGLSTDVIAA FSTDQIAALS TAAVAALSTK QVDALSTGQL      1380
     AVLTTAQIGA LTSRQVDALS TDDVATLTTD QIAALSAAGV VGLSTADIAI LSSGQVDALT      1440
     TSQIAALGSK QIAALGTDDI AGFSVAEIAA LSSSAVAGLS TETIAALSAE QIAALSTAGI      1500
     AGLSTAQVNA LSTDQIGALS TEQVAALSSK QVAALGTDDM AALSADQIAA LGTTGIAVLS      1560
     SAQIDALSAE QLEALTSVQV AALSSTQIAA LSTDDLAAFS TADIAAISSA AVAGLSTDTL      1620
     AALSADQIAA LSAAGIADLS TAQINALSAD QLEALSTDQI AALSSKQVAA LGTDDIAALS      1680
     TEQIAALSTA GVAALSTAQI QALSADQLEA LTPSQVAVMS STQIAALSTA DLESFSSADI      1740
     GAIGSSAVAG LSTDTLAALS ADQIAALSAT GVAGLSTVQI LALSTDQIEA LSTDQIAALS      1800
     SKQLAVLGTD DIAVLSTDQI AALGTAAIAG LSTTQINALN ADQLEAMTSG QVAVMSSTQI      1860
     AALSTGDLES FSTADIAAIS SRAVAGLSTD TIAALSADQI AALGTGGVAG LSTAQINALN      1920
     TDQVEALTSL QIGALTSQQI AVLGTDDLET FSTDEIAAIS STAVLGLSTD TIAALSVDQV      1980
     AALSSAGISG LSTAQINALS TDQIEALSTA QIGGLGSKQV AALGTADLAV LSTSQIAALS      2040
     TAGIAGLSSE QVGALSDEQV EALSTVQIAA MSSDALSGLS TDDLEGFSVE ELAAISSSAI      2100
     RGLSTDFIAG LSTAEIAALG TASLAGLSSA QVGAMSAEQI DTLSTLQIAA LSADGLAGLT      2160
     TEDLGTFTTG ELVAISAAAI KGLSTTFVAA LSTAEIAALT ASQVGSLSYN QVAAMSTTQI      2220
     ATLSTAQLSA LNAIQAAALG TDDIAQLSTD DIVALGTSAI SGLTTRVVAA LTTDQAEALT      2280
     AVQVGAMTSA QVAALETEDL ATFSAEDVAS FSSYGVAGLS TEDIGNLSST QLNALMDSQM      2340
     DALDSDQIAA VIAAYLGM                                                    2358
//

If you have problems or comments...

PBIL Back to PBIL home page