(data stored in ACNUC7421 zone)

EMBL: CP001389.PE235

CP001389.PE235       Location/Qualifiers
FT   CDS             complement(281304..281591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02410"
FT                   /product="hypothetical protein"
FT                   /note="similar to transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24039"
FT                   /db_xref="GOA:C3MFY8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY8"
FT                   /protein_id="ACP24039.1"
FT                   /translation="MFHGHNRKETLMGIESILVFLIVGAIAGWLAGLIVSGFGFGLIGN
FT                   IVVGIIGALIAGYLFPAVGITLGTGILAAIIHSTIGAIILLVLIRIVKQA"
     MFHGHNRKET LMGIESILVF LIVGAIAGWL AGLIVSGFGF GLIGNIVVGI IGALIAGYLF        60
     PAVGITLGTG ILAAIIHSTI GAIILLVLIR IVKQA                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page