(data stored in ACNUC7421 zone)

EMBL: CP001389.PE239

CP001389.PE239       Location/Qualifiers
FT   CDS             286363..287352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02450"
FT                   /product="rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24043"
FT                   /db_xref="GOA:C3MFZ2"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ2"
FT                   /protein_id="ACP24043.1"
FT                   /translation="MKILKSLMVTAAVAAALMANAAHAENKKIALVVKALGIGFFEAAN
FT                   KGAQEAAKELGDVEIIYTGPTSTTAEGQIEVINSLIAQKVDAIAVSANDTDALVPALKK
FT                   AMDRGIKVISWDSGVAKEGRLMHLNPSSSPLIGNMIIKLAADNLPEGGDVAVLSASATA
FT                   TNQNTWIAEMKKVQVNYKGINVVATVYGDDLADKSYRETQGLIQSHPNLKAIIAPTSIG
FT                   IVAAAQAVTDAGKIGQINVTGLGLPSEMAGHVKSGASKSFAIWNPIDLGYSATMIAYDI
FT                   INGAEAKPGAELKMGRMGTVKLDDNNEGAMADPFVYDASNVEEFAKIF"
     MKILKSLMVT AAVAAALMAN AAHAENKKIA LVVKALGIGF FEAANKGAQE AAKELGDVEI        60
     IYTGPTSTTA EGQIEVINSL IAQKVDAIAV SANDTDALVP ALKKAMDRGI KVISWDSGVA       120
     KEGRLMHLNP SSSPLIGNMI IKLAADNLPE GGDVAVLSAS ATATNQNTWI AEMKKVQVNY       180
     KGINVVATVY GDDLADKSYR ETQGLIQSHP NLKAIIAPTS IGIVAAAQAV TDAGKIGQIN       240
     VTGLGLPSEM AGHVKSGASK SFAIWNPIDL GYSATMIAYD IINGAEAKPG AELKMGRMGT       300
     VKLDDNNEGA MADPFVYDAS NVEEFAKIF                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page