(data stored in ACNUC7421 zone)

EMBL: CP001389.PE24

CP001389.PE24        Location/Qualifiers
FT   CDS             complement(20887..21345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00240"
FT                   /product="predicted carbon monoxide dehydrogenase subunit
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23828"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK5"
FT                   /protein_id="ACP23828.1"
FT                   /translation="MDITGEERIAARREAVWQCLNDPDILKRCIPGCQAVEAVSPTELT
FT                   AVVKVKIGPVSATFNGKVTLSNLNPPESYTISGEGKGGIAGFAKGGADVTLAEESDETL
FT                   LSYDVKAEVGGKLAQLGSRLIDSTAKKLAQQFFANLNLAVSGAAEAAS"
     MDITGEERIA ARREAVWQCL NDPDILKRCI PGCQAVEAVS PTELTAVVKV KIGPVSATFN        60
     GKVTLSNLNP PESYTISGEG KGGIAGFAKG GADVTLAEES DETLLSYDVK AEVGGKLAQL       120
     GSRLIDSTAK KLAQQFFANL NLAVSGAAEA AS                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page