(data stored in ACNUC7421 zone)

EMBL: CP001389.PE244

CP001389.PE244       Location/Qualifiers
FT   CDS             291461..292831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02500"
FT                   /product="predicted carbohydrate kinase contains FGGY
FT                   family domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24048"
FT                   /db_xref="GOA:C3MFZ7"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ7"
FT                   /protein_id="ACP24048.1"
FT                   /translation="MKTVAVIDIGKTNAKIALVDLEQFEEIAVRKTPNVVVKDGLYPHF
FT                   DVEYLWRFILDSLAALHRERPVDAISVTTHGATAVLLNDAGELAMPVLDYEYAGPDALS
FT                   EEYGQARPPFSETGSARLPMGLNVGAQLFWQQRMFPRDFAEVATILTYAQYWSYRLTGV
FT                   ATNELTSLGCHTDLWNPKTATFSTMVEARGWTPLFAPVRKADEVIGGLLPALAEATGLP
FT                   DRLPVYCGIHDSNASLLPHLLTRSAPFSVVSTGTWVVMMSVGGEQVELDERRDTLINVN
FT                   ALGDPVPSARFMGGRAFSLLIGDDPPPPSAEAERRVLAEGRMLLPSVPGGSGPFPSAEP
FT                   RWTVNEDNLTPAERLAAVSFHLSLMTATCLDLIGARGEIVVEGPFAANSAYLRMLAAAT
FT                   GRLVLANRLSSTGTSLGAACLVAGATIRTGAEAFSEAVPRSYVDYAHKWQRLTAEHV"
     MKTVAVIDIG KTNAKIALVD LEQFEEIAVR KTPNVVVKDG LYPHFDVEYL WRFILDSLAA        60
     LHRERPVDAI SVTTHGATAV LLNDAGELAM PVLDYEYAGP DALSEEYGQA RPPFSETGSA       120
     RLPMGLNVGA QLFWQQRMFP RDFAEVATIL TYAQYWSYRL TGVATNELTS LGCHTDLWNP       180
     KTATFSTMVE ARGWTPLFAP VRKADEVIGG LLPALAEATG LPDRLPVYCG IHDSNASLLP       240
     HLLTRSAPFS VVSTGTWVVM MSVGGEQVEL DERRDTLINV NALGDPVPSA RFMGGRAFSL       300
     LIGDDPPPPS AEAERRVLAE GRMLLPSVPG GSGPFPSAEP RWTVNEDNLT PAERLAAVSF       360
     HLSLMTATCL DLIGARGEIV VEGPFAANSA YLRMLAAATG RLVLANRLSS TGTSLGAACL       420
     VAGATIRTGA EAFSEAVPRS YVDYAHKWQR LTAEHV                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page