(data stored in ACNUC7421 zone)

EMBL: CP001389.PE245

CP001389.PE245       Location/Qualifiers
FT   CDS             293522..295135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02510"
FT                   /product="predicted chemotaxis methyl-accepting receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24049"
FT                   /db_xref="GOA:C3MFZ8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ8"
FT                   /protein_id="ACP24049.1"
FT                   /translation="MQQEASEQARKGQAGSLLERLRFAGLDERACALLRDHRQVLSPSI
FT                   ELALRDLFQRLQANPDAVRHFDSDRQLDRLHDLQSSHWNVLTDARFDGLYAERVKVLAD
FT                   TEARMGLDPRWQLASHAVVLEHLIVGAIENAWPKSLLPFGKARRSELCRLVAALVRAAF
FT                   VDGEIAVSLRFNALRQQHQRHLSDQRKGDESEVAALFSDFLQALGTGDLGARLPTDAPD
FT                   AYRPIAAGLNAALDQIQNALLSGDKRAAAAETIVESLRGRTSEFSGSASGEAEALTGQV
FT                   AALGAMTERMRSGSIRISETETRASETRQAAERSGEIAGQAISAMADIEASAEKIGQII
FT                   GVIDEIAFQTNLLALNAGIEAARAGESGRGFAVVAQEVRALAQRSGEAAREIKQLVNGT
FT                   KTQVEAGVEIVGQTQNAISSIVDQVISINAAVSGIAREAETQVNDLAAAASEIGGISKA
FT                   MARSATLAGEAAASTEDLHGTILELGQTIRRFRFERQAGLRASTIAPPPALLPQVDGDE
FT                   AAMPFSDDTALGRHVAGWRR"
     MQQEASEQAR KGQAGSLLER LRFAGLDERA CALLRDHRQV LSPSIELALR DLFQRLQANP        60
     DAVRHFDSDR QLDRLHDLQS SHWNVLTDAR FDGLYAERVK VLADTEARMG LDPRWQLASH       120
     AVVLEHLIVG AIENAWPKSL LPFGKARRSE LCRLVAALVR AAFVDGEIAV SLRFNALRQQ       180
     HQRHLSDQRK GDESEVAALF SDFLQALGTG DLGARLPTDA PDAYRPIAAG LNAALDQIQN       240
     ALLSGDKRAA AAETIVESLR GRTSEFSGSA SGEAEALTGQ VAALGAMTER MRSGSIRISE       300
     TETRASETRQ AAERSGEIAG QAISAMADIE ASAEKIGQII GVIDEIAFQT NLLALNAGIE       360
     AARAGESGRG FAVVAQEVRA LAQRSGEAAR EIKQLVNGTK TQVEAGVEIV GQTQNAISSI       420
     VDQVISINAA VSGIAREAET QVNDLAAAAS EIGGISKAMA RSATLAGEAA ASTEDLHGTI       480
     LELGQTIRRF RFERQAGLRA STIAPPPALL PQVDGDEAAM PFSDDTALGR HVAGWRR          537
//

If you have problems or comments...

PBIL Back to PBIL home page