(data stored in ACNUC7421 zone)

EMBL: CP001389.PE246

CP001389.PE246       Location/Qualifiers
FT   CDS             295165..295458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24050"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ9"
FT                   /protein_id="ACP24050.1"
FT                   /translation="MASKNTAKKSLKLAPVLDLNEATALHERLLSLKGSPVAIDASAVE
FT                   RIGTLCAQVLMAGARSWEEDRVSFTFAKVSDAFVKTTQLIGVDIAPLMAKEI"
     MASKNTAKKS LKLAPVLDLN EATALHERLL SLKGSPVAID ASAVERIGTL CAQVLMAGAR        60
     SWEEDRVSFT FAKVSDAFVK TTQLIGVDIA PLMAKEI                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page