(data stored in ACNUC7421 zone)

EMBL: CP001389.PE25

CP001389.PE25        Location/Qualifiers
FT   CDS             21597..22739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23829"
FT                   /db_xref="GOA:C3MEK6"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK6"
FT                   /protein_id="ACP23829.1"
FT                   /translation="MKEKDRRSKNASVTAAKGRGAEARGGRHEPRHPSAKSGAPKGKAG
FT                   GLPSPKAAAQKSPRSAAQESTPARSIEPRSGEKPAETVPLILETVPTAGYHLIDSGDGE
FT                   KLEQYGPYRIVRPEAQALWPKALPAAVWEKADAIFTGDTDEDGMGRWRFPREALGETWP
FT                   MQLLDTDFLGRFTSFRHVGVFPEQLAHWSWMKDQVAASGRPLKVLNLFGYTGVASLVAA
FT                   KAGAEVTHVDASKKAIGWARENQAMARAEKLPIRWICDDAMKFIQREERRGSRYDIILT
FT                   DPPKFGRGPNGEVWQLFDHLAAMLDICREILSPDARGLVLTAYSIRASFYSIHELMRET
FT                   MRGRGGRVESGELIIREGGLDGKAPGRALSTSLFSRWVPK"
     MKEKDRRSKN ASVTAAKGRG AEARGGRHEP RHPSAKSGAP KGKAGGLPSP KAAAQKSPRS        60
     AAQESTPARS IEPRSGEKPA ETVPLILETV PTAGYHLIDS GDGEKLEQYG PYRIVRPEAQ       120
     ALWPKALPAA VWEKADAIFT GDTDEDGMGR WRFPREALGE TWPMQLLDTD FLGRFTSFRH       180
     VGVFPEQLAH WSWMKDQVAA SGRPLKVLNL FGYTGVASLV AAKAGAEVTH VDASKKAIGW       240
     ARENQAMARA EKLPIRWICD DAMKFIQREE RRGSRYDIIL TDPPKFGRGP NGEVWQLFDH       300
     LAAMLDICRE ILSPDARGLV LTAYSIRASF YSIHELMRET MRGRGGRVES GELIIREGGL       360
     DGKAPGRALS TSLFSRWVPK                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page