(data stored in ACNUC7421 zone)

EMBL: CP001389.PE252

CP001389.PE252       Location/Qualifiers
FT   CDS             300567..300956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02580"
FT                   /product="predicted signal transduction response regulator,
FT                   contains receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24056"
FT                   /db_xref="GOA:C3MG05"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG05"
FT                   /protein_id="ACP24056.1"
FT                   /translation="MSIAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMK
FT                   IMAQNPHHLVISDFNMPKMDGLGLLQAVRSNPNTKKAAFIILTAQGDRALVQKAAALGA
FT                   NNVLAKPFTIEKMKAAIEAVFGALK"
     MSIAEKIKVL IVDDQVTSRL LLGDALQQLG FKQITAAGDG EQGMKIMAQN PHHLVISDFN        60
     MPKMDGLGLL QAVRSNPNTK KAAFIILTAQ GDRALVQKAA ALGANNVLAK PFTIEKMKAA       120
     IEAVFGALK                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page