(data stored in ACNUC7421 zone)

EMBL: CP001389.PE254

CP001389.PE254       Location/Qualifiers
FT   CDS             301571..301957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG07"
FT                   /protein_id="ACP24058.1"
FT                   /translation="MQTDHQSYMPHAEESLPEVLMRIVTELHDVAYLIERIEPQLWNGH
FT                   DGSATEDKMMVLQGIDLAVQKTRGLAEFIDTITASIPDTCLVDISTAVNLVKLADMKKA
FT                   LGNGLLRHGHSQPLTKASGDFEAF"
     MQTDHQSYMP HAEESLPEVL MRIVTELHDV AYLIERIEPQ LWNGHDGSAT EDKMMVLQGI        60
     DLAVQKTRGL AEFIDTITAS IPDTCLVDIS TAVNLVKLAD MKKALGNGLL RHGHSQPLTK       120
     ASGDFEAF                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page