(data stored in ACNUC7421 zone)

EMBL: CP001389.PE258

CP001389.PE258       Location/Qualifiers
FT   CDS             complement(306382..306822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24062"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG11"
FT                   /protein_id="ACP24062.1"
FT                   /translation="MKKCEFSEKREKLVAEAIRPVATELRLIDAADFIALLRFESHASL
FT                   ADLVESAAELYFLPGTVNFGLGGNYNLDWNSRPEIILDLELKPRGVTVYARLVLAGEAA
FT                   GIEISHINFQHPSTDPDENTAFLARSLEEAKFVKSYPLPLAS"
     MKKCEFSEKR EKLVAEAIRP VATELRLIDA ADFIALLRFE SHASLADLVE SAAELYFLPG        60
     TVNFGLGGNY NLDWNSRPEI ILDLELKPRG VTVYARLVLA GEAAGIEISH INFQHPSTDP       120
     DENTAFLARS LEEAKFVKSY PLPLAS                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page