(data stored in ACNUC7421 zone)

EMBL: CP001389.PE267

CP001389.PE267       Location/Qualifiers
FT   CDS             314891..315442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24071"
FT                   /db_xref="GOA:C3MG20"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG20"
FT                   /protein_id="ACP24071.1"
FT                   /translation="MTDNEADEIVHQRRRDAKMPLTDKVLGAIGLAMAAFATFFPWYAF
FT                   LHQDQFSIPPLWRGTTRDLPERPGRGVVSVSPLAMTDVDAETAAAIDRLTTATVPGLEH
FT                   QPAAGAGEPQAGPEQPFPEPSGFKLMHVANGRALIEDATGMYIVRIGSVLPDNSRLATF
FT                   EERNGRWVMITSKGQVYQAN"
     MTDNEADEIV HQRRRDAKMP LTDKVLGAIG LAMAAFATFF PWYAFLHQDQ FSIPPLWRGT        60
     TRDLPERPGR GVVSVSPLAM TDVDAETAAA IDRLTTATVP GLEHQPAAGA GEPQAGPEQP       120
     FPEPSGFKLM HVANGRALIE DATGMYIVRI GSVLPDNSRL ATFEERNGRW VMITSKGQVY       180
     QAN                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page