(data stored in ACNUC7421 zone)

EMBL: CP001389.PE272

CP001389.PE272       Location/Qualifiers
FT   CDS             317584..318093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02780"
FT                   /product="SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24076"
FT                   /db_xref="GOA:C3MG25"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG25"
FT                   /protein_id="ACP24076.1"
FT                   /translation="MMFRRSAERAAIEGRFARLTRPLAFAAIAAALLSPALVSAQQPTA
FT                   VIPKQIIYPGETIEASMLEVVDVTNPDLADGYIGSLEEVEGKVTKRTLLPGRVILASAL
FT                   RDRYAVERGSTVRLIFNNGGLTITAAGSPLEDAAVGELIRARNIDSGVIVSGTVMADGT
FT                   VHVVAK"
     MMFRRSAERA AIEGRFARLT RPLAFAAIAA ALLSPALVSA QQPTAVIPKQ IIYPGETIEA        60
     SMLEVVDVTN PDLADGYIGS LEEVEGKVTK RTLLPGRVIL ASALRDRYAV ERGSTVRLIF       120
     NNGGLTITAA GSPLEDAAVG ELIRARNIDS GVIVSGTVMA DGTVHVVAK                   169
//

If you have problems or comments...

PBIL Back to PBIL home page