(data stored in ACNUC7421 zone)

EMBL: CP001389.PE273

CP001389.PE273       Location/Qualifiers
FT   CDS             318090..319205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02790"
FT                   /product="flagellar P-ring protein precursor"
FT                   /note="basal body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24077"
FT                   /db_xref="GOA:C3MG26"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG26"
FT                   /protein_id="ACP24077.1"
FT                   /translation="MTMRVCKWLLTFALLFAATLTPAHSASRIKDVASLQAGRDNQLIG
FT                   YGLVVGLQGTGDSLRSSPFTDQSIRAMLQNLGISTQGGESRTRNVAAVLVTATLPPFAS
FT                   PGSRVDVTVGSLGDATSLRGGTLVMTSLSGADGQIYAVAQGSIVVTGFSAQGDAASLSQ
FT                   GVTTAGRVPNGAIIERELPSKFKDGFNLVLQLRNPDFSTAVGMAAAINKFASAQFGGRI
FT                   AEALDSQSVLVQKPKMADLARLMADIENLVVETDVPARVVVNERTGTIVIGQDVRVNEV
FT                   AVSYGTLTVQVTETPTVVQPAPFSRGETAVEPNTTIEAQSDGGTVAILNGSSLRSLVAG
FT                   LNSIGVKPDGIIAILQSIKTAGALQAELVLQ"
     MTMRVCKWLL TFALLFAATL TPAHSASRIK DVASLQAGRD NQLIGYGLVV GLQGTGDSLR        60
     SSPFTDQSIR AMLQNLGIST QGGESRTRNV AAVLVTATLP PFASPGSRVD VTVGSLGDAT       120
     SLRGGTLVMT SLSGADGQIY AVAQGSIVVT GFSAQGDAAS LSQGVTTAGR VPNGAIIERE       180
     LPSKFKDGFN LVLQLRNPDF STAVGMAAAI NKFASAQFGG RIAEALDSQS VLVQKPKMAD       240
     LARLMADIEN LVVETDVPAR VVVNERTGTI VIGQDVRVNE VAVSYGTLTV QVTETPTVVQ       300
     PAPFSRGETA VEPNTTIEAQ SDGGTVAILN GSSLRSLVAG LNSIGVKPDG IIAILQSIKT       360
     AGALQAELVL Q                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page