(data stored in ACNUC7421 zone)

EMBL: CP001389.PE274

CP001389.PE274       Location/Qualifiers
FT   CDS             319202..319741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG27"
FT                   /protein_id="ACP24078.1"
FT                   /translation="MTGTMDLLPGKSRRTLLAAAGGALMLVMPGAFAQDVTAPPAENGA
FT                   TNEIQQFCTNIADAARDQRYLLQRKDLETLQASVDERIATLEKRRAEYEDWLKRRNDFL
FT                   KQAELGLVDIYKTMKPDAAAGKLEMVRPEIAAAIVMKLPARQSSLILSEMSDEKAAVLT
FT                   NIISSASDPNTSKEPS"
     MTGTMDLLPG KSRRTLLAAA GGALMLVMPG AFAQDVTAPP AENGATNEIQ QFCTNIADAA        60
     RDQRYLLQRK DLETLQASVD ERIATLEKRR AEYEDWLKRR NDFLKQAELG LVDIYKTMKP       120
     DAAAGKLEMV RPEIAAAIVM KLPARQSSLI LSEMSDEKAA VLTNIISSAS DPNTSKEPS        179
//

If you have problems or comments...

PBIL Back to PBIL home page