(data stored in ACNUC7421 zone)

EMBL: CP001389.PE278

CP001389.PE278       Location/Qualifiers
FT   CDS             322029..322937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02840"
FT                   /product="flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24082"
FT                   /db_xref="GOA:C3MG31"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG31"
FT                   /protein_id="ACP24082.1"
FT                   /translation="MASILTNSSATAALQTLRSISSSMEDTQNRISTGMRVGSASDNAA
FT                   YWSIATTMRSDNAALSSVTDALGMGAAKVDTAYAGMEAAIDVVKEIKAKIVAATEEGVD
FT                   GAKVQEEIDQLQDQLLSIAESASFNGENWIAGEAATKTVVTGFVRASDGTVSIKTSSYT
FT                   LTDAADGTLLFADDGAGGLDTATGILGTAGTNGNDVYGLDISAMDATALGEALSDVEDA
FT                   LTAMTSAASSLGSMSTRIDLQADFVSELSDSIENGIGRLVDADMNEESTRLKALQTQQQ
FT                   LAIQALSIANSDSQNILSLFR"
     MASILTNSSA TAALQTLRSI SSSMEDTQNR ISTGMRVGSA SDNAAYWSIA TTMRSDNAAL        60
     SSVTDALGMG AAKVDTAYAG MEAAIDVVKE IKAKIVAATE EGVDGAKVQE EIDQLQDQLL       120
     SIAESASFNG ENWIAGEAAT KTVVTGFVRA SDGTVSIKTS SYTLTDAADG TLLFADDGAG       180
     GLDTATGILG TAGTNGNDVY GLDISAMDAT ALGEALSDVE DALTAMTSAA SSLGSMSTRI       240
     DLQADFVSEL SDSIENGIGR LVDADMNEES TRLKALQTQQ QLAIQALSIA NSDSQNILSL       300
     FR                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page