(data stored in ACNUC7421 zone)

EMBL: CP001389.PE28

CP001389.PE28        Location/Qualifiers
FT   CDS             24140..26407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00280"
FT                   /product="sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23832"
FT                   /db_xref="GOA:C3MEK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK9"
FT                   /protein_id="ACP23832.1"
FT                   /translation="MSEPFSAQQRKQAGPGAMPAAVDVARSATAMAGRPPPVARRSPVD
FT                   RETSVGHILLAVAGLAAAALLLVAGARAGLHLLPAVAAVGALAGAFLLLSREGAASRQA
FT                   SEPGSGADRTERCSETAKLLSTIHDALGDIALVRGMDGKIVQANAVFSRVCGRVDVRGL
FT                   TCASLGLSFEPRPDPDRFIVRFATPAGLRLYDWHDVVIREPASGRLMRHSIARDVTEEA
FT                   QAVRRGEEARLRAEEASQAKSRLLATVTHEIRTPLSGILGMSHLLAQTQLSAEQRNYLA
FT                   DMQQSGHALVQLVEDLIDFSSLSAGRFQLHPSEQELRLVIENVVEMLSHRAHEKGIEIG
FT                   VAIDASVPPRFGFDAARLRQVLFNVIGNAVKFTEAGGVLVTADYGEGHVRIRVDDSGPG
FT                   MSADELARVFEEFEQAGDHAQRSKGTGLGLAISRRIMEAFGGSLIASSVTGEGSRFEIR
FT                   FPVDEALSAAQPRRGALADAHVLLLAPDGPASMALAATIKTLGGQCHRAPTLSAAREVI
FT                   ARPLAGALPLTDIIVDHRHASQLRQLLLLEPALERQRLRKTCLISPEERSSHPVNRMGG
FT                   YEAWLIRPLREKSLVEVLLGRMTGIEKRDGINDNRPILRAEPRKAAAVSPDRRRVLLAE
FT                   DDPVNALVLRKMLERAGHGVDHVGDFAALEAALQGRAAPGLIVTDFNMPGGDGLALLRR
FT                   LRGVEAAGKGNRVPVVVLTSDVRSDLHRLLLAAGADAVLTKPAEPERFLAEVARLLDAG
FT                   QA"
     MSEPFSAQQR KQAGPGAMPA AVDVARSATA MAGRPPPVAR RSPVDRETSV GHILLAVAGL        60
     AAAALLLVAG ARAGLHLLPA VAAVGALAGA FLLLSREGAA SRQASEPGSG ADRTERCSET       120
     AKLLSTIHDA LGDIALVRGM DGKIVQANAV FSRVCGRVDV RGLTCASLGL SFEPRPDPDR       180
     FIVRFATPAG LRLYDWHDVV IREPASGRLM RHSIARDVTE EAQAVRRGEE ARLRAEEASQ       240
     AKSRLLATVT HEIRTPLSGI LGMSHLLAQT QLSAEQRNYL ADMQQSGHAL VQLVEDLIDF       300
     SSLSAGRFQL HPSEQELRLV IENVVEMLSH RAHEKGIEIG VAIDASVPPR FGFDAARLRQ       360
     VLFNVIGNAV KFTEAGGVLV TADYGEGHVR IRVDDSGPGM SADELARVFE EFEQAGDHAQ       420
     RSKGTGLGLA ISRRIMEAFG GSLIASSVTG EGSRFEIRFP VDEALSAAQP RRGALADAHV       480
     LLLAPDGPAS MALAATIKTL GGQCHRAPTL SAAREVIARP LAGALPLTDI IVDHRHASQL       540
     RQLLLLEPAL ERQRLRKTCL ISPEERSSHP VNRMGGYEAW LIRPLREKSL VEVLLGRMTG       600
     IEKRDGINDN RPILRAEPRK AAAVSPDRRR VLLAEDDPVN ALVLRKMLER AGHGVDHVGD       660
     FAALEAALQG RAAPGLIVTD FNMPGGDGLA LLRRLRGVEA AGKGNRVPVV VLTSDVRSDL       720
     HRLLLAAGAD AVLTKPAEPE RFLAEVARLL DAGQA                                  755
//

If you have problems or comments...

PBIL Back to PBIL home page