(data stored in ACNUC7421 zone)

EMBL: CP001389.PE281

CP001389.PE281       Location/Qualifiers
FT   CDS             325638..326600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02870"
FT                   /product="flagellin protein FlaD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24085"
FT                   /db_xref="GOA:C3MG34"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG34"
FT                   /protein_id="ACP24085.1"
FT                   /translation="MTSIMTNAAAMAALQTLRSINRNLDETQSRVSSGYRVETAADNAA
FT                   YWSIATTMRSDNAALSTVQDALGLGAAKVDTAYAALDTVIDLMSEVKAKLVAAREPGVD
FT                   KTKIDKELAQLKEQLVSAAQSASFSGENWLYNDAATAVGTKSIVASFNRSADGSVSVTT
FT                   LDYDTSGSILVDVQDASRGLLTMAVDADTLVSAPTGSAREYYLIDAGSPPAGTEIALSE
FT                   TTTDEELDDMISVVDDLVSQLTNSAATLGAITSRIEMQENFVANLMDVIDKGVGRLVDA
FT                   DMNEESTRLKALQTQQQLGIQSLSIANTNSENILRLFQE"
     MTSIMTNAAA MAALQTLRSI NRNLDETQSR VSSGYRVETA ADNAAYWSIA TTMRSDNAAL        60
     STVQDALGLG AAKVDTAYAA LDTVIDLMSE VKAKLVAARE PGVDKTKIDK ELAQLKEQLV       120
     SAAQSASFSG ENWLYNDAAT AVGTKSIVAS FNRSADGSVS VTTLDYDTSG SILVDVQDAS       180
     RGLLTMAVDA DTLVSAPTGS AREYYLIDAG SPPAGTEIAL SETTTDEELD DMISVVDDLV       240
     SQLTNSAATL GAITSRIEMQ ENFVANLMDV IDKGVGRLVD ADMNEESTRL KALQTQQQLG       300
     IQSLSIANTN SENILRLFQE                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page