(data stored in ACNUC7421 zone)

EMBL: CP001389.PE282

CP001389.PE282       Location/Qualifiers
FT   CDS             326975..327628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24086"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG35"
FT                   /protein_id="ACP24086.1"
FT                   /translation="MSASLSRYLKDFSAPKIELTRMPPKYFPDLEADFPTEDRSAQRPT
FT                   MPEIDVDAERREAFAQGRAEAAAELAFEHQRELAELKARHAEELDAVRHRLAEETASKL
FT                   AAGFDQITERLALALGDQTARVLAPVLEAALLKRAIEDLATMIRQGVGAGEGLTITVKG
FT                   SPVLFEALKQHLDDDTLLFRHVVADDIDLTVELGETVLVTRMAAWSDTVRKVLA"
     MSASLSRYLK DFSAPKIELT RMPPKYFPDL EADFPTEDRS AQRPTMPEID VDAERREAFA        60
     QGRAEAAAEL AFEHQRELAE LKARHAEELD AVRHRLAEET ASKLAAGFDQ ITERLALALG       120
     DQTARVLAPV LEAALLKRAI EDLATMIRQG VGAGEGLTIT VKGSPVLFEA LKQHLDDDTL       180
     LFRHVVADDI DLTVELGETV LVTRMAAWSD TVRKVLA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page