(data stored in ACNUC7421 zone)

EMBL: CP001389.PE286

CP001389.PE286       Location/Qualifiers
FT   CDS             331533..332096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02920"
FT                   /product="putative lytic transglycosylase-like protein,
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24090"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG39"
FT                   /protein_id="ACP24090.1"
FT                   /translation="MERTMRLLALGTLALVTSTCSALASAGICEREIASAAAKYGIPTG
FT                   ILYSVGLTETGRKGSLQPYAMNIEGKAYFGTSVQDVLGRFGAARAQGAKLIDLGCMQIN
FT                   YHFHGEHFSSPEEMLDPRRNVDYAARFLSNLRARHESWTMAVARYHAGPNNDPAQKKYV
FT                   CRVIANLVATGYGKWTPNAAQFCQ"
     MERTMRLLAL GTLALVTSTC SALASAGICE REIASAAAKY GIPTGILYSV GLTETGRKGS        60
     LQPYAMNIEG KAYFGTSVQD VLGRFGAARA QGAKLIDLGC MQINYHFHGE HFSSPEEMLD       120
     PRRNVDYAAR FLSNLRARHE SWTMAVARYH AGPNNDPAQK KYVCRVIANL VATGYGKWTP       180
     NAAQFCQ                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page