(data stored in ACNUC7421 zone)

EMBL: CP001389.PE29

CP001389.PE29        Location/Qualifiers
FT   CDS             26505..27395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23833"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ6"
FT                   /protein_id="ACP23833.1"
FT                   /translation="MTIDLLDSTSVVDTSQVRSRKTIAAPATDVLGRIANLETRLARTA
FT                   AEIDAAQAVRYRVFVEEMKAQVTPEAERRKRDVDGWDAICDHLLVLDTSIEGDAEEQIV
FT                   GTYRLLRQEVAARAGGFYSASEFAIDDLLARHPDKRFMELGRSCVLPEYRTKRTVELLW
FT                   QGNWAYALKHGIDAMFGCGSLPGVVPEEHALALSFLHHNLLARDQWAVAARPELYRTMD
FT                   LMPPEAINPKKALAALPPLIKGYMRLGAMVGDGAVVDHAFRTTDVLIVLPISNISGRYL
FT                   NYYGADAGRFSSSVS"
     MTIDLLDSTS VVDTSQVRSR KTIAAPATDV LGRIANLETR LARTAAEIDA AQAVRYRVFV        60
     EEMKAQVTPE AERRKRDVDG WDAICDHLLV LDTSIEGDAE EQIVGTYRLL RQEVAARAGG       120
     FYSASEFAID DLLARHPDKR FMELGRSCVL PEYRTKRTVE LLWQGNWAYA LKHGIDAMFG       180
     CGSLPGVVPE EHALALSFLH HNLLARDQWA VAARPELYRT MDLMPPEAIN PKKALAALPP       240
     LIKGYMRLGA MVGDGAVVDH AFRTTDVLIV LPISNISGRY LNYYGADAGR FSSSVS           296
//

If you have problems or comments...

PBIL Back to PBIL home page