(data stored in ACNUC7421 zone)

EMBL: CP001389.PE297

CP001389.PE297       Location/Qualifiers
FT   CDS             341514..341927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24101"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG50"
FT                   /protein_id="ACP24101.1"
FT                   /translation="MKSRSKKLKRLVDVQRHLERMAESELAETTRQRGVLSETIDVVVD
FT                   AMGSAHPMHRVFSGHYAAQLGRLVQKDQMLLGIQQVHEARMLKERAKGDRLQESMEEAR
FT                   MTEDREADDNQVLDLIDQHVAGYAPASGKLEGR"
     MKSRSKKLKR LVDVQRHLER MAESELAETT RQRGVLSETI DVVVDAMGSA HPMHRVFSGH        60
     YAAQLGRLVQ KDQMLLGIQQ VHEARMLKER AKGDRLQESM EEARMTEDRE ADDNQVLDLI       120
     DQHVAGYAPA SGKLEGR                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page