(data stored in ACNUC7421 zone)

EMBL: CP001389.PE298

CP001389.PE298       Location/Qualifiers
FT   CDS             342017..342562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24102"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI7"
FT                   /protein_id="ACP24102.1"
FT                   /translation="MAISPPSDLVLDVVRAADPAEVQEAQTRLKANRAAFQATSLAENG
FT                   NGFAAAVSVLNSSEGSTGLGDVSNRVEPKKVPETYRKFEAMVLQNFVKSMLPSESESVF
FT                   GKGTSGEVWKGMMAEQIANVLADGGGIGIADRMAGSDTADRASARLDDDTSNIAAGMVH
FT                   EYERKAGFFTTDDKKNQA"
     MAISPPSDLV LDVVRAADPA EVQEAQTRLK ANRAAFQATS LAENGNGFAA AVSVLNSSEG        60
     STGLGDVSNR VEPKKVPETY RKFEAMVLQN FVKSMLPSES ESVFGKGTSG EVWKGMMAEQ       120
     IANVLADGGG IGIADRMAGS DTADRASARL DDDTSNIAAG MVHEYERKAG FFTTDDKKNQ       180
     A                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page