(data stored in ACNUC7421 zone)

EMBL: CP001389.PE299

CP001389.PE299       Location/Qualifiers
FT   CDS             342635..343003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24103"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI8"
FT                   /protein_id="ACP24103.1"
FT                   /translation="MEAVASHDLRIQNVLGRLEMIIDNENSRIGVDPKFDIKTSNAHKS
FT                   RCLYELTMLHRDTAAGEISPSFASQTRHLRQKLKLNAQKVEAHLEAVRSVVDLLKTAAQ
FT                   DADADGIYTEAQFRYSDF"
     MEAVASHDLR IQNVLGRLEM IIDNENSRIG VDPKFDIKTS NAHKSRCLYE LTMLHRDTAA        60
     GEISPSFASQ TRHLRQKLKL NAQKVEAHLE AVRSVVDLLK TAAQDADADG IYTEAQFRYS       120
     DF                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page