(data stored in ACNUC7421 zone)

EMBL: CP001389.PE30

CP001389.PE30        Location/Qualifiers
FT   CDS             complement(27793..30078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00300"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23834"
FT                   /db_xref="GOA:C3MEZ7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ7"
FT                   /protein_id="ACP23834.1"
FT                   /translation="MPATDKTDRTMTSVTAQEALDFHSQGRPGKLEISPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAEDPATAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   SVLFKRFADVDSIDLEVDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFIIEQRLREV
FT                   MDIPVFHDDQHGTAIIAAAGLINALALTGRDFKTTKLVCNGAGAAAIACIELIKAMGFN
FT                   PENIILCDTKGVIFQGRTEGMNQWKSAHAVKTDRRTLAEAVEGSDVFFGLSAKGALSPE
FT                   MVRSMAARPIIFAMANPDPEITPEEVAQIRDDAIVATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAAEALASLAKEDVPDDVAAAYQGNRPRFGPQYIIPVPFDPRLIS
FT                   AIPMAVAKAAMETGVAQKPIADLNAYGQQLSARRDPIASTLQRIFERVRRQPKRIVFAE
FT                   GEEVQMMRSAIAYANQQLGTAILLGREEQMRETAEREGIDLDRPGIQIVNARLSKRVSA
FT                   YTDFLYARLQRKGYLFRDVQRLINNDRNHFAASMVALGDADGMVTGLTRNYSTALEDVR
FT                   RCIDAKPGHRVIGVSIALCRGRTVLVADTAVHDMPSAEELADIAEEAAGLAKRLGYMPR
FT                   VAMLAYSTFGHPSGERSERVREAVKILDRRRVDFEYDGEMAADVALNHRVLEQYPFCRL
FT                   SGTANVLVMPAFHSASISTKMLQELGGSTVIGPLLVGFDKSVQITSMSAKDSDIVNLAA
FT                   IAAYNAGT"
     MPATDKTDRT MTSVTAQEAL DFHSQGRPGK LEISPTKPMA TQRDLSLAYS PGVAVPVKAI        60
     AEDPATAYDY TARGNMVAVI SNGTAILGLG NLGALASKPV MEGKSVLFKR FADVDSIDLE       120
     VDTENVDEFI NCVRFLGPSF GGINLEDIKA PDCFIIEQRL REVMDIPVFH DDQHGTAIIA       180
     AAGLINALAL TGRDFKTTKL VCNGAGAAAI ACIELIKAMG FNPENIILCD TKGVIFQGRT       240
     EGMNQWKSAH AVKTDRRTLA EAVEGSDVFF GLSAKGALSP EMVRSMAARP IIFAMANPDP       300
     EITPEEVAQI RDDAIVATGR SDYPNQVNNV LGFPYIFRGA LDVRASTIND AMKIAAAEAL       360
     ASLAKEDVPD DVAAAYQGNR PRFGPQYIIP VPFDPRLISA IPMAVAKAAM ETGVAQKPIA       420
     DLNAYGQQLS ARRDPIASTL QRIFERVRRQ PKRIVFAEGE EVQMMRSAIA YANQQLGTAI       480
     LLGREEQMRE TAEREGIDLD RPGIQIVNAR LSKRVSAYTD FLYARLQRKG YLFRDVQRLI       540
     NNDRNHFAAS MVALGDADGM VTGLTRNYST ALEDVRRCID AKPGHRVIGV SIALCRGRTV       600
     LVADTAVHDM PSAEELADIA EEAAGLAKRL GYMPRVAMLA YSTFGHPSGE RSERVREAVK       660
     ILDRRRVDFE YDGEMAADVA LNHRVLEQYP FCRLSGTANV LVMPAFHSAS ISTKMLQELG       720
     GSTVIGPLLV GFDKSVQITS MSAKDSDIVN LAAIAAYNAG T                           761
//

If you have problems or comments...

PBIL Back to PBIL home page