(data stored in ACNUC7421 zone)

EMBL: CP001389.PE300

CP001389.PE300       Location/Qualifiers
FT   CDS             343003..343569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24104"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI9"
FT                   /protein_id="ACP24104.1"
FT                   /translation="MLKLVLTGVWVCAVTLGSVYFSMQYASAPIVSDAEADRRASEEYV
FT                   PGEIITVPVIEEGAVQGYFLAKLSFSATREGIAKLHAPLRQVVTDELYDMLVGSRFVDV
FT                   ADTGTFDLPSFKVAVKDGLNKKLGGEVITEVLVEQLEYLGKDDMKRVANGNNRPYQEPV
FT                   PVVDKHGNVASDKIPEGAVKASSGH"
     MLKLVLTGVW VCAVTLGSVY FSMQYASAPI VSDAEADRRA SEEYVPGEII TVPVIEEGAV        60
     QGYFLAKLSF SATREGIAKL HAPLRQVVTD ELYDMLVGSR FVDVADTGTF DLPSFKVAVK       120
     DGLNKKLGGE VITEVLVEQL EYLGKDDMKR VANGNNRPYQ EPVPVVDKHG NVASDKIPEG       180
     AVKASSGH                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page