(data stored in ACNUC7421 zone)

EMBL: CP001389.PE304

CP001389.PE304       Location/Qualifiers
FT   CDS             347293..348651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03100"
FT                   /product="predicted alpha-glucoside ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24108"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ3"
FT                   /protein_id="ACP24108.1"
FT                   /translation="MKRSLLIGVAALALLAGAASAADLKFKPGEDSKFNWGSFEEFKKG
FT                   HDLKGQTLTIFGPWRGEDEALFKSVFAYFVEATGVEVKYSSSENYEQQIVIDTQAGSPP
FT                   DVAILPQPGLIADLAAKGLLTPLGDETKQWLLDNYAAGQSWVDLSTYSGKDGAAALYAF
FT                   PYKIDVKSLVWYVPENFEDAGYEVPKTMEELKALTEKIAADGEKPWCIGLGSGGATGWP
FT                   ATDWVEDLMLRTQSPEVYDKWTKNEIPFTDPAVTGALDEFGWFARNDKFVDGGAAAVAS
FT                   TDFRDSPKGLFASPPKCYLHHQASFIPSFFPEGTVVGEDADFFYMPPYESKKELGNPVL
FT                   GAGTLAMITKDTPAARAFIEFLKTPIAHEVWMAQTSFLTPYKSVNVEVYGNPPLKKQGE
FT                   ILLNATTFRFDGSDLMPGKIGAGALWTGMVDYVGGKSSADVAADVQKAWDAIK"
     MKRSLLIGVA ALALLAGAAS AADLKFKPGE DSKFNWGSFE EFKKGHDLKG QTLTIFGPWR        60
     GEDEALFKSV FAYFVEATGV EVKYSSSENY EQQIVIDTQA GSPPDVAILP QPGLIADLAA       120
     KGLLTPLGDE TKQWLLDNYA AGQSWVDLST YSGKDGAAAL YAFPYKIDVK SLVWYVPENF       180
     EDAGYEVPKT MEELKALTEK IAADGEKPWC IGLGSGGATG WPATDWVEDL MLRTQSPEVY       240
     DKWTKNEIPF TDPAVTGALD EFGWFARNDK FVDGGAAAVA STDFRDSPKG LFASPPKCYL       300
     HHQASFIPSF FPEGTVVGED ADFFYMPPYE SKKELGNPVL GAGTLAMITK DTPAARAFIE       360
     FLKTPIAHEV WMAQTSFLTP YKSVNVEVYG NPPLKKQGEI LLNATTFRFD GSDLMPGKIG       420
     AGALWTGMVD YVGGKSSADV AADVQKAWDA IK                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page