(data stored in ACNUC7421 zone)

EMBL: CP001389.PE305

CP001389.PE305       Location/Qualifiers
FT   CDS             348902..349909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03110"
FT                   /product="predicted alpha-glucoside transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24109"
FT                   /db_xref="GOA:C3MGJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ4"
FT                   /protein_id="ACP24109.1"
FT                   /translation="MQLLAAILTMIVGVLACAAYFWATNFILDRIFPSKGLSGVTASRN
FT                   LRITNAIRPWLFLAPALFALTIYLIYPVVQSVWLSFHDRGGQSFVGARNYSWMINDGEF
FT                   RQSIFNNFLWLLVVPALSTFFGLIIAALTDRIWWGNIAKTLIFMPMAISFVGAAVIWKF
FT                   IYDYRAEGSEQIGLLNAIVVAFGGAPEAWITLPFWNNFFLMVILIWIQTGFAMVILSAA
FT                   LRGIPEETIEAAVIDGANGWQIFFKIMVPQIWGTIAVVWTTITILVLKVFDIVLAMTNG
FT                   QWQSQVLANLMFDWMFRGGGDFGRGASIAVVIMVLVIPIMIWNIRNATKESGGH"
     MQLLAAILTM IVGVLACAAY FWATNFILDR IFPSKGLSGV TASRNLRITN AIRPWLFLAP        60
     ALFALTIYLI YPVVQSVWLS FHDRGGQSFV GARNYSWMIN DGEFRQSIFN NFLWLLVVPA       120
     LSTFFGLIIA ALTDRIWWGN IAKTLIFMPM AISFVGAAVI WKFIYDYRAE GSEQIGLLNA       180
     IVVAFGGAPE AWITLPFWNN FFLMVILIWI QTGFAMVILS AALRGIPEET IEAAVIDGAN       240
     GWQIFFKIMV PQIWGTIAVV WTTITILVLK VFDIVLAMTN GQWQSQVLAN LMFDWMFRGG       300
     GDFGRGASIA VVIMVLVIPI MIWNIRNATK ESGGH                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page