(data stored in ACNUC7421 zone)

EMBL: CP001389.PE306

CP001389.PE306       Location/Qualifiers
FT   CDS             349911..351059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03120"
FT                   /product="predicted alpha-glucoside ABC transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24110"
FT                   /db_xref="GOA:C3MGJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ5"
FT                   /protein_id="ACP24110.1"
FT                   /translation="MNPSTRSPLTWAVHLSVLLLVVLWTMPTAGLLISSLRDKDQLAVS
FT                   GWWTALATSSRNDVARAPSADSQVERDGKFVISGNLLEGQGGGQISAFGFSSREPGKFK
FT                   AGETAELNDGERLTVQADGSFEIVSDTKMEGSRGQRIFYTAATPPRFTIDNYIEVLSAA
FT                   GIGTSFLNSLTVAIPSTVIPILIAAFAAYALAWMPFPGRAILLAVVVGLLVVPLQMSLI
FT                   PLLQLYNGVGAFFGVPAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVDGA
FT                   SDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGEDSLVLTGRLVNLLGS
FT                   RGGNWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKGG"
     MNPSTRSPLT WAVHLSVLLL VVLWTMPTAG LLISSLRDKD QLAVSGWWTA LATSSRNDVA        60
     RAPSADSQVE RDGKFVISGN LLEGQGGGQI SAFGFSSREP GKFKAGETAE LNDGERLTVQ       120
     ADGSFEIVSD TKMEGSRGQR IFYTAATPPR FTIDNYIEVL SAAGIGTSFL NSLTVAIPST       180
     VIPILIAAFA AYALAWMPFP GRAILLAVVV GLLVVPLQMS LIPLLQLYNG VGAFFGVPAK       240
     TYMGIWLAHT GFGLPLAIYL LRNYMAGLPR EIMESARVDG ASDFDIFVKI ILPLSFPALA       300
     SFAIFQFLWT WNDLLVAIVF LGAGEDSLVL TGRLVNLLGS RGGNWEILTA SAFITIVVPL       360
     IVFFALQRYL VRGLLAGSVK GG                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page