(data stored in ACNUC7421 zone)

EMBL: CP001389.PE308

CP001389.PE308       Location/Qualifiers
FT   CDS             352762..353850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03140"
FT                   /product="alpha-glucoside ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24112"
FT                   /db_xref="GOA:C3MGJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ7"
FT                   /protein_id="ACP24112.1"
FT                   /translation="MTGLLLKDIRKSYGAVDVIHGINLDIKQGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEEITGGDMFIDGQRVNEVPPSQRGIAMVFQSYALYPHMTVYDNMAFGMRIAK
FT                   ETKEEIDRRVRSAADILQLTKYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSN
FT                   LDAALRVATRIEIAKLSERMADTTMIYVTHDQVEAMTLADRIVVLSLGHIEQVGAPLEL
FT                   YERPANLFVARFIGSPAMNVFPSTITATGAQTTVTLAGGKSVTLDIPTNASEAGKKASF
FT                   GVRPEDLQVTDGQDFLFEGTISIVEALGEVTLLYIEGLVENEPIIAKIPGILKVGRGDK
FT                   VRFTADKAKLHLFDADGRSYRA"
     MTGLLLKDIR KSYGAVDVIH GINLDIKQGE FVVFVGPSGC GKSTLLRMIA GLEEITGGDM        60
     FIDGQRVNEV PPSQRGIAMV FQSYALYPHM TVYDNMAFGM RIAKETKEEI DRRVRSAADI       120
     LQLTKYLDRL PKALSGGQRQ RVAIGRAICR NPKVFLFDEP LSNLDAALRV ATRIEIAKLS       180
     ERMADTTMIY VTHDQVEAMT LADRIVVLSL GHIEQVGAPL ELYERPANLF VARFIGSPAM       240
     NVFPSTITAT GAQTTVTLAG GKSVTLDIPT NASEAGKKAS FGVRPEDLQV TDGQDFLFEG       300
     TISIVEALGE VTLLYIEGLV ENEPIIAKIP GILKVGRGDK VRFTADKAKL HLFDADGRSY       360
     RA                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page