(data stored in ACNUC7421 zone)

EMBL: CP001389.PE309

CP001389.PE309       Location/Qualifiers
FT   CDS             353966..354394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24113"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ8"
FT                   /protein_id="ACP24113.1"
FT                   /translation="MRKVYSMRSDAPVMQQHFLNKEESFMYDREANFPMEDTRNDARIE
FT                   FTEKGMQNLSSRRCEIIKLSKSSAVIGIVTKFQLPQNFYLDIPSARIPLIGCLLKRVHA
FT                   NNLIEARFLRLLSDRDLNRIFVYSTHPNHRNRTLDIYR"
     MRKVYSMRSD APVMQQHFLN KEESFMYDRE ANFPMEDTRN DARIEFTEKG MQNLSSRRCE        60
     IIKLSKSSAV IGIVTKFQLP QNFYLDIPSA RIPLIGCLLK RVHANNLIEA RFLRLLSDRD       120
     LNRIFVYSTH PNHRNRTLDI YR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page