(data stored in ACNUC7421 zone)

EMBL: CP001389.PE310

CP001389.PE310       Location/Qualifiers
FT   CDS             354428..354805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03160"
FT                   /product="hypothetical protein"
FT                   /note="similar to glutathione-dependent
FT                   formaldehyde-activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24114"
FT                   /db_xref="GOA:C3MGJ9"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ9"
FT                   /protein_id="ACP24114.1"
FT                   /translation="MRAAMQRPYRLSCHCGEIAIEVDAELSRLVECNCSTCRRSGFLHW
FT                   KVDAAAVRLLTEKRRMSTYIWRGIGEGHHFCPTCGTAILRSGYPGDRVSLNARCIEGVD
FT                   VFTLEVDRYDGRNDMPPGPLP"
     MRAAMQRPYR LSCHCGEIAI EVDAELSRLV ECNCSTCRRS GFLHWKVDAA AVRLLTEKRR        60
     MSTYIWRGIG EGHHFCPTCG TAILRSGYPG DRVSLNARCI EGVDVFTLEV DRYDGRNDMP       120
     PGPLP                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page