(data stored in ACNUC7421 zone)

EMBL: CP001389.PE316

CP001389.PE316       Location/Qualifiers
FT   CDS             362087..363271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03220"
FT                   /product="predicted HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24120"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK5"
FT                   /protein_id="ACP24120.1"
FT                   /translation="MIETQDVVIIGAGAAGMMCAIEAGKRGRRVVVIDHARAPGEKIRI
FT                   SGGGRCNFTNIHAGPKNFLSDNPHFCKSALARYRPQDFVSLVERHGIAWHEKTLGQLFC
FT                   DHSAKDIIRMLLAEMKEVGAMLRLETTISAVERTASGFRVATSAGTVDTASLVVASGGK
FT                   SIPKMGATGLAYRIAEQFGLPVVETRPALVPFTLDPAQLEKLGGLAGVAADAEVRFGKI
FT                   AFREAVLVTHRGLSGPAILQISSYWREGAEIVLRLMPDIDIASILKGMRRTGGRQAAQT
FT                   ALADILPRRLAQFFAEEAKLAGRLLADLSDKAIDALSASIQAWTLKPAGTEGYRTAEVT
FT                   LGGVDTRALDSRTMRATNIPGLYFIGECVDVTGWLGGYNFQWAWASGFAAGQDV"
     MIETQDVVII GAGAAGMMCA IEAGKRGRRV VVIDHARAPG EKIRISGGGR CNFTNIHAGP        60
     KNFLSDNPHF CKSALARYRP QDFVSLVERH GIAWHEKTLG QLFCDHSAKD IIRMLLAEMK       120
     EVGAMLRLET TISAVERTAS GFRVATSAGT VDTASLVVAS GGKSIPKMGA TGLAYRIAEQ       180
     FGLPVVETRP ALVPFTLDPA QLEKLGGLAG VAADAEVRFG KIAFREAVLV THRGLSGPAI       240
     LQISSYWREG AEIVLRLMPD IDIASILKGM RRTGGRQAAQ TALADILPRR LAQFFAEEAK       300
     LAGRLLADLS DKAIDALSAS IQAWTLKPAG TEGYRTAEVT LGGVDTRALD SRTMRATNIP       360
     GLYFIGECVD VTGWLGGYNF QWAWASGFAA GQDV                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page