(data stored in ACNUC7421 zone)

EMBL: CP001389.PE317

CP001389.PE317       Location/Qualifiers
FT   CDS             363980..366505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03230"
FT                   /product="predicted chemoreceptor y4fA"
FT                   /note="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24121"
FT                   /db_xref="GOA:C3MGK6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK6"
FT                   /protein_id="ACP24121.1"
FT                   /translation="MLIDRILARFKIQTKVLFFILPFVVSITAVGITGLYASGLLQGRM
FT                   EISNSVLQTLSGFKDVYAGMNQFLHETTEESRNAVLDTIAAQEQVLADTAAQVAGASGE
FT                   TELDAAIVATNDIEARIDGLWTLHEGEQKLRAATKANLEKLAAEQVKISDETNRLQYAV
FT                   RKDENAAKTMLRNAEKLMRASRFYTEFATEVSKAITVEEKVKVAQELFPRISRTQRDIF
FT                   TLLPKGEKSLAETVNSAAGGIGALIKAPAAPETLGGLAKFVDRFRNASFRLEAASVGKM
FT                   REATQIFAELDSKIAATESVLTATRRLSVSITEIQIATAAFLGNTTEENRQKLLDKFLA
FT                   VQANLTTLRGIAKDLSFFDATADVVVPIIDAMKKDGVSLVEITDKRTAEFNAAGASINE
FT                   IWNDLTGFAEQQKVAAGTEREEANQISVAATVAGVVIALLAGIALTLTLKRPIGQITAA
FT                   MRRLADGMLDTAIDGDARRDEIGDMARALGVFKENALSKVRIEAESAEERARSEAERNR
FT                   NDADKRELDRQIDVAVSELAAGLGRLAQGDLSQQIEVPFHGRLEQLRQDFNGSLIRLQD
FT                   TLAQIRGNAQAIQQGGANMHQSADALSRRTEAQAASLEQTAAAVDQITATVRSSAERAH
FT                   EANQSVSETKRSADSSATVVANAIAAMGRIEDASRQIEQIIEVIDDIAFQTNLLALNAG
FT                   IEAARAGEAGKGFAVVAQEVRELAQRSAEAAREIKGLINKSTDEVSSGSLLVKETGAVL
FT                   ASISAQIVTVSQHVDMIATASRDQATALHEVNGSVNQMDQMTQQNASMVEEATATSRAL
FT                   ATQADTLMMLVEQFRLEPENGAGQVYRAA"
     MLIDRILARF KIQTKVLFFI LPFVVSITAV GITGLYASGL LQGRMEISNS VLQTLSGFKD        60
     VYAGMNQFLH ETTEESRNAV LDTIAAQEQV LADTAAQVAG ASGETELDAA IVATNDIEAR       120
     IDGLWTLHEG EQKLRAATKA NLEKLAAEQV KISDETNRLQ YAVRKDENAA KTMLRNAEKL       180
     MRASRFYTEF ATEVSKAITV EEKVKVAQEL FPRISRTQRD IFTLLPKGEK SLAETVNSAA       240
     GGIGALIKAP AAPETLGGLA KFVDRFRNAS FRLEAASVGK MREATQIFAE LDSKIAATES       300
     VLTATRRLSV SITEIQIATA AFLGNTTEEN RQKLLDKFLA VQANLTTLRG IAKDLSFFDA       360
     TADVVVPIID AMKKDGVSLV EITDKRTAEF NAAGASINEI WNDLTGFAEQ QKVAAGTERE       420
     EANQISVAAT VAGVVIALLA GIALTLTLKR PIGQITAAMR RLADGMLDTA IDGDARRDEI       480
     GDMARALGVF KENALSKVRI EAESAEERAR SEAERNRNDA DKRELDRQID VAVSELAAGL       540
     GRLAQGDLSQ QIEVPFHGRL EQLRQDFNGS LIRLQDTLAQ IRGNAQAIQQ GGANMHQSAD       600
     ALSRRTEAQA ASLEQTAAAV DQITATVRSS AERAHEANQS VSETKRSADS SATVVANAIA       660
     AMGRIEDASR QIEQIIEVID DIAFQTNLLA LNAGIEAARA GEAGKGFAVV AQEVRELAQR       720
     SAEAAREIKG LINKSTDEVS SGSLLVKETG AVLASISAQI VTVSQHVDMI ATASRDQATA       780
     LHEVNGSVNQ MDQMTQQNAS MVEEATATSR ALATQADTLM MLVEQFRLEP ENGAGQVYRA       840
     A                                                                       841
//

If you have problems or comments...

PBIL Back to PBIL home page