(data stored in ACNUC7421 zone)

EMBL: CP001389.PE319

CP001389.PE319       Location/Qualifiers
FT   CDS             complement(367936..368175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK8"
FT                   /protein_id="ACP24123.1"
FT                   /translation="MTVQTRVKERAEEQSSAMTPDQQAAIRMVANDLHRLNQSVMKAVE
FT                   AGVSVELVRSARHHGGGGNWGDLLIPVIVTQGRS"
     MTVQTRVKER AEEQSSAMTP DQQAAIRMVA NDLHRLNQSV MKAVEAGVSV ELVRSARHHG        60
     GGGNWGDLLI PVIVTQGRS                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page