(data stored in ACNUC7421 zone)

EMBL: CP001389.PE322

CP001389.PE322       Location/Qualifiers
FT   CDS             370353..371447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03280"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24126"
FT                   /db_xref="GOA:C3MGL1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL1"
FT                   /protein_id="ACP24126.1"
FT                   /translation="MSKFIVATLAAAMLAGSATLASAQERVVNVYNWSDYIDESILEEF
FT                   TKETGIKVVYDVFDSNEILETKLLAGGSGYDVVVPTAYFLQRQIAAGVFQKLDKSKLPN
FT                   LSNMWDLILERTAKYDPGNEYAVDYMWGTTGIGYNVDKMKEILGTDAKPNWDVIFNPEI
FT                   AAKFKDCGIHLLDSPTDIIPSALAYLGLNPDSHDPADLEKAADVLLKVRPYIRKFHSSE
FT                   YINALANGDICLAVGFSGDIFQARDRAAEAKAGVTVDYSIPAQGAQMWFDMLAMPADAP
FT                   HVAEAHEFINFMMKPEVIAKASNYVFYANGNKASQQFLDREVLEDTAIYPTDDVMQKLF
FT                   TVTPFEPKEQRVLTRLWTKIVTGQ"
     MSKFIVATLA AAMLAGSATL ASAQERVVNV YNWSDYIDES ILEEFTKETG IKVVYDVFDS        60
     NEILETKLLA GGSGYDVVVP TAYFLQRQIA AGVFQKLDKS KLPNLSNMWD LILERTAKYD       120
     PGNEYAVDYM WGTTGIGYNV DKMKEILGTD AKPNWDVIFN PEIAAKFKDC GIHLLDSPTD       180
     IIPSALAYLG LNPDSHDPAD LEKAADVLLK VRPYIRKFHS SEYINALANG DICLAVGFSG       240
     DIFQARDRAA EAKAGVTVDY SIPAQGAQMW FDMLAMPADA PHVAEAHEFI NFMMKPEVIA       300
     KASNYVFYAN GNKASQQFLD REVLEDTAIY PTDDVMQKLF TVTPFEPKEQ RVLTRLWTKI       360
     VTGQ                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page