(data stored in ACNUC7421 zone)

EMBL: CP001389.PE323

CP001389.PE323       Location/Qualifiers
FT   CDS             371575..372720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03290"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24127"
FT                   /db_xref="GOA:C3MGL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL2"
FT                   /protein_id="ACP24127.1"
FT                   /translation="MMKSLGSIRRSFAPWADPASKPFISVKNVTKKFGDFIAVDDLSLN
FT                   IYTREFFALLGASGCGKSTLLRMLAGFEQPTSGEIILDGQNLAGIPPYRRPVNMMFQSY
FT                   ALFPHMTVENNIAFGLKQDGMPKPEIAERVAQMLKLVKLEKFAQRKPHQLSGGQRQRVA
FT                   LARSLAKRPKVLLLDEPLGALDKKLREETQFELMDLQQDLGLTFVIVTHDQEEAMTMAD
FT                   RIAVMSHGKVVQVATPAEIYEAPNSRFVADFIGDVNLFDGTVTAAEGALVRIETTGGIP
FT                   LRMASVENLASGAKAAVAIRPEKIRISRQPPAHAPINTAEGEIWDIGYLGDMTVFHVRL
FT                   KDGKVVKASSLNAVRAVEDPLGYDQQIWISFGEDAGVVLKD"
     MMKSLGSIRR SFAPWADPAS KPFISVKNVT KKFGDFIAVD DLSLNIYTRE FFALLGASGC        60
     GKSTLLRMLA GFEQPTSGEI ILDGQNLAGI PPYRRPVNMM FQSYALFPHM TVENNIAFGL       120
     KQDGMPKPEI AERVAQMLKL VKLEKFAQRK PHQLSGGQRQ RVALARSLAK RPKVLLLDEP       180
     LGALDKKLRE ETQFELMDLQ QDLGLTFVIV THDQEEAMTM ADRIAVMSHG KVVQVATPAE       240
     IYEAPNSRFV ADFIGDVNLF DGTVTAAEGA LVRIETTGGI PLRMASVENL ASGAKAAVAI       300
     RPEKIRISRQ PPAHAPINTA EGEIWDIGYL GDMTVFHVRL KDGKVVKASS LNAVRAVEDP       360
     LGYDQQIWIS FGEDAGVVLK D                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page