(data stored in ACNUC7421 zone)

EMBL: CP001389.PE326

CP001389.PE326       Location/Qualifiers
FT   CDS             complement(374737..376662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03320"
FT                   /product="AsmA protein family precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24130"
FT                   /db_xref="GOA:C3MGL5"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL5"
FT                   /protein_id="ACP24130.1"
FT                   /translation="MAAPQPRGRHFHVSCICPPQGLSKRFHRGDADPTEMTRPIRKISR
FT                   ILRLRLRRRHFVWSAAVGVLLAMGYNAALPLLVSTTGVRATMERTLDSWSGGKSRINGE
FT                   PEVRFWPKLLLTLPSATIESTGPDPRPLAEIGRITASFSPLSALLGDPTLEDISLVDPV
FT                   ITIERRADGTTNWQTPHWLAPPEAPASGRETAFGDIAIVNGRLRVLDRTAGGNDVDIAG
FT                   ISGTIKWPSFAERLSAQLSARLRDEEIAWAIVCEEPLALFARRNASLKTSITSAPVTFS
FT                   FEGVGNLSSVPFASGHLQMSATSLATLVQWYQGTSTETLPSGGLSIDTRVTTGEKTLKL
FT                   DDLAFTMGGASATGVLDIALQDGKAPSVEGTLAFDRIDLNGVPVAALTPFGRDDRLWRL
FT                   AETFVGAWHTDIRLSSQEVLAGPLHLTEVAAGVLIDGKRASLDIGDSNYANGSLSGRVV
FT                   LSDQGLEHGGRLQARLKDANFAAVLASFGLAGPIPAGRGILNIDIGTERAVWAAGSGDF
FT                   SGNLSFSLANGSIAGFDAPAFADLVRKGEFFSLSQANEASFDFQSATVKASFANGTARL
FT                   DRADFVGPSGQLSVAGVIPYRNGSLALAGTLKTEAPTGNQPVLFFVGGSWPNAVISPLS
FT                   VLVAPK"
     MAAPQPRGRH FHVSCICPPQ GLSKRFHRGD ADPTEMTRPI RKISRILRLR LRRRHFVWSA        60
     AVGVLLAMGY NAALPLLVST TGVRATMERT LDSWSGGKSR INGEPEVRFW PKLLLTLPSA       120
     TIESTGPDPR PLAEIGRITA SFSPLSALLG DPTLEDISLV DPVITIERRA DGTTNWQTPH       180
     WLAPPEAPAS GRETAFGDIA IVNGRLRVLD RTAGGNDVDI AGISGTIKWP SFAERLSAQL       240
     SARLRDEEIA WAIVCEEPLA LFARRNASLK TSITSAPVTF SFEGVGNLSS VPFASGHLQM       300
     SATSLATLVQ WYQGTSTETL PSGGLSIDTR VTTGEKTLKL DDLAFTMGGA SATGVLDIAL       360
     QDGKAPSVEG TLAFDRIDLN GVPVAALTPF GRDDRLWRLA ETFVGAWHTD IRLSSQEVLA       420
     GPLHLTEVAA GVLIDGKRAS LDIGDSNYAN GSLSGRVVLS DQGLEHGGRL QARLKDANFA       480
     AVLASFGLAG PIPAGRGILN IDIGTERAVW AAGSGDFSGN LSFSLANGSI AGFDAPAFAD       540
     LVRKGEFFSL SQANEASFDF QSATVKASFA NGTARLDRAD FVGPSGQLSV AGVIPYRNGS       600
     LALAGTLKTE APTGNQPVLF FVGGSWPNAV ISPLSVLVAP K                           641
//

If you have problems or comments...

PBIL Back to PBIL home page