(data stored in ACNUC7421 zone)

EMBL: CP001389.PE328

CP001389.PE328       Location/Qualifiers
FT   CDS             complement(378945..380627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03340"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24132"
FT                   /db_xref="GOA:C3MGL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL7"
FT                   /protein_id="ACP24132.1"
FT                   /translation="MHSTAKSLKRHYAKPGSGLTHRLLASWSGLASAIVLMPIVAIAWL
FT                   AVTGGGADWPHLIENVIPRATMRTLMLMGLTGAATAVVGILTAWLVATCEFPLRRLLSA
FT                   ALVLPLAIPAYLAAYAFGELLTFTGPVQGLIRALFGFQTSRDYWFPDVRSLGGAVLVMS
FT                   SVLYPYIYLACRSMFLMQGRAAADVARTLGAGPLKVFMKIQIPMARPAIMIGLTLVAME
FT                   TMNDIGAVEFLGVQTLTFSIFDTWLNRGSLAGAAQIACIMLVFIVALMMVERAARRSQR
FT                   FSSQKTTAAVHDAARLELSGWKKWAATLACLLPVLSGFAVPFLVLGNYALKRLDHFLAP
FT                   RLIDALLHSVLVSSLTALAAVFLGFVLAYAARTGRSPITEVAGRLASFGYGVPGTVLAI
FT                   GVLFPLAALDNALDARMRDVFGISTGLVLSGTGFAIVYACAVRFLTMAEGTLEAGFHKL
FT                   SPHLDMAARALGRTSAQTLRSVLLPMMRPAVLTSALLVFIETMKELSATIMLRPFNFNT
FT                   LATLVYEDASRAKVEDASVAAMIIVVAGMIPVILVSRSLESRS"
     MHSTAKSLKR HYAKPGSGLT HRLLASWSGL ASAIVLMPIV AIAWLAVTGG GADWPHLIEN        60
     VIPRATMRTL MLMGLTGAAT AVVGILTAWL VATCEFPLRR LLSAALVLPL AIPAYLAAYA       120
     FGELLTFTGP VQGLIRALFG FQTSRDYWFP DVRSLGGAVL VMSSVLYPYI YLACRSMFLM       180
     QGRAAADVAR TLGAGPLKVF MKIQIPMARP AIMIGLTLVA METMNDIGAV EFLGVQTLTF       240
     SIFDTWLNRG SLAGAAQIAC IMLVFIVALM MVERAARRSQ RFSSQKTTAA VHDAARLELS       300
     GWKKWAATLA CLLPVLSGFA VPFLVLGNYA LKRLDHFLAP RLIDALLHSV LVSSLTALAA       360
     VFLGFVLAYA ARTGRSPITE VAGRLASFGY GVPGTVLAIG VLFPLAALDN ALDARMRDVF       420
     GISTGLVLSG TGFAIVYACA VRFLTMAEGT LEAGFHKLSP HLDMAARALG RTSAQTLRSV       480
     LLPMMRPAVL TSALLVFIET MKELSATIML RPFNFNTLAT LVYEDASRAK VEDASVAAMI       540
     IVVAGMIPVI LVSRSLESRS                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page