(data stored in ACNUC7421 zone)

EMBL: CP001389.PE329

CP001389.PE329       Location/Qualifiers
FT   CDS             complement(380709..384062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03350"
FT                   /product="predicted sensor histidine kinase protein with
FT                   ATP-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24133"
FT                   /db_xref="GOA:C3MGL8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL8"
FT                   /protein_id="ACP24133.1"
FT                   /translation="MPARQYPFIDIAVHARVREHFARGDAAVLFSKDLARVLWANDQGA
FT                   RLFGVASVYDFIDGALSATDLSLRQLRAAAEQLAAVGDRRQLLIRIAAGFRRLPLNATV
FT                   EMIRIRPGEEAVLFTAPHNGKALSAEERAAAMIAGLDGPDTHMAVLDDDGEIVARSPGF
FT                   EHLGLSGDIRRTLVSAVAREKDRLIKRLVATEKGQLPAAIGKISDHPALHLLFAVETTL
FT                   DTPDAEEAAAKDEPDAIAAAAAEVGTGLPSPTTLDEPAETPLREDTSEAEATTDPAATD
FT                   EPTDAPSLGEEHGELALRSGDEAADLAPSAEAAEPAPEVATSDADSAAAAASGFTFTPG
FT                   SRAVRFVWKIDAEGCFSEISEEFAAAVGPKSADVVGLTFSELAARYDLDPDNKVNALLH
FT                   RRDTWSGKTILWPIEGTSLKVPVDLAALPTYSRSREFDGFRGFGIVRIADAVEDEKASG
FT                   LSLGHIDTPRNEGMPAEAPSDDAPREPASLASDGTDTPRSEAEPPSAEDPFAGERPALR
FT                   IVDIPARPPSDKVIDLDEHRPGSSGTLTRGEQAAFREIARQLGAQFSETTPPAAADEDG
FT                   KRPVDAASQAEAAGDMESLSSEDATAARQEETMPGAGDEAPPAPRGGVGMSSEILDRLP
FT                   VALLIHHGDELLHANPEFLRLTGYRKLEAFQQAGGLEALFAYGAESGEHEPDGTMTLVR
FT                   ANGPLAPVSAHLHSIQWEGRSALMLALAPAAARAADMPSAGADASAGGEARLRMEIDEL
FT                   RSILETATDGVVVLGQDGDIRTMNGSASALFNYDEDEMRGKPFAALFAHESQKAVIDYL
FT                   QGLSGHGVASVLNDGREAIGREAGGGFLPLFMTIGRLSSSNGYCAVIRDITQWKRTEEE
FT                   LRNAKRSAETANAHKTEFLARVSHEIRTPLNAIIGFSDMMASEHFGPIGNPRYIEYAGD
FT                   IGRSGRHVLDIVNDLLDISKIEAGEMELDFSAVDLNEAVSEAVSLVQPQANSQRVIIRT
FT                   SLSGSVPEVVADGRSIKQIALNILANAIRFTPSGGQIVVSTSYETNGSVILRIRDTGIG
FT                   MTRNELDQAMKPFRQVTTGGRKRGEGTGLGLPLTKAMAEANRAQFGISSAPNEGTLVEI
FT                   SFPSQRVLAN"
     MPARQYPFID IAVHARVREH FARGDAAVLF SKDLARVLWA NDQGARLFGV ASVYDFIDGA        60
     LSATDLSLRQ LRAAAEQLAA VGDRRQLLIR IAAGFRRLPL NATVEMIRIR PGEEAVLFTA       120
     PHNGKALSAE ERAAAMIAGL DGPDTHMAVL DDDGEIVARS PGFEHLGLSG DIRRTLVSAV       180
     AREKDRLIKR LVATEKGQLP AAIGKISDHP ALHLLFAVET TLDTPDAEEA AAKDEPDAIA       240
     AAAAEVGTGL PSPTTLDEPA ETPLREDTSE AEATTDPAAT DEPTDAPSLG EEHGELALRS       300
     GDEAADLAPS AEAAEPAPEV ATSDADSAAA AASGFTFTPG SRAVRFVWKI DAEGCFSEIS       360
     EEFAAAVGPK SADVVGLTFS ELAARYDLDP DNKVNALLHR RDTWSGKTIL WPIEGTSLKV       420
     PVDLAALPTY SRSREFDGFR GFGIVRIADA VEDEKASGLS LGHIDTPRNE GMPAEAPSDD       480
     APREPASLAS DGTDTPRSEA EPPSAEDPFA GERPALRIVD IPARPPSDKV IDLDEHRPGS       540
     SGTLTRGEQA AFREIARQLG AQFSETTPPA AADEDGKRPV DAASQAEAAG DMESLSSEDA       600
     TAARQEETMP GAGDEAPPAP RGGVGMSSEI LDRLPVALLI HHGDELLHAN PEFLRLTGYR       660
     KLEAFQQAGG LEALFAYGAE SGEHEPDGTM TLVRANGPLA PVSAHLHSIQ WEGRSALMLA       720
     LAPAAARAAD MPSAGADASA GGEARLRMEI DELRSILETA TDGVVVLGQD GDIRTMNGSA       780
     SALFNYDEDE MRGKPFAALF AHESQKAVID YLQGLSGHGV ASVLNDGREA IGREAGGGFL       840
     PLFMTIGRLS SSNGYCAVIR DITQWKRTEE ELRNAKRSAE TANAHKTEFL ARVSHEIRTP       900
     LNAIIGFSDM MASEHFGPIG NPRYIEYAGD IGRSGRHVLD IVNDLLDISK IEAGEMELDF       960
     SAVDLNEAVS EAVSLVQPQA NSQRVIIRTS LSGSVPEVVA DGRSIKQIAL NILANAIRFT      1020
     PSGGQIVVST SYETNGSVIL RIRDTGIGMT RNELDQAMKP FRQVTTGGRK RGEGTGLGLP      1080
     LTKAMAEANR AQFGISSAPN EGTLVEISFP SQRVLAN                               1117
//

If you have problems or comments...

PBIL Back to PBIL home page