(data stored in ACNUC7421 zone)

EMBL: CP001389.PE330

CP001389.PE330       Location/Qualifiers
FT   CDS             384382..384828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03360"
FT                   /product="hypothetical protein"
FT                   /note="similar to phasin 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24134"
FT                   /db_xref="InterPro:IPR010234"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL9"
FT                   /protein_id="ACP24134.1"
FT                   /translation="MATKKTEDAFALSFDPAKFADSFRDFAEKGAAQSKDAYAKMKTAA
FT                   EEATKTVEATLESAQSGSVELGLKAINALRTNAENSLSHMEALLGVKSLSELVELQTAF
FT                   IRKQAELAVEQAKTMQEATRKVAENVAKPGKEAAEKVVSTFKKA"
     MATKKTEDAF ALSFDPAKFA DSFRDFAEKG AAQSKDAYAK MKTAAEEATK TVEATLESAQ        60
     SGSVELGLKA INALRTNAEN SLSHMEALLG VKSLSELVEL QTAFIRKQAE LAVEQAKTMQ       120
     EATRKVAENV AKPGKEAAEK VVSTFKKA                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page