(data stored in ACNUC7421 zone)

EMBL: CP001389.PE331

CP001389.PE331       Location/Qualifiers
FT   CDS             complement(385185..386066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03380"
FT                   /product="putative LysR family transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24135"
FT                   /db_xref="GOA:C3MGM0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM0"
FT                   /protein_id="ACP24135.1"
FT                   /translation="MDWDDVRVFLAVARTGQILAASKRLGINHATLSRRVTALEETLKT
FT                   RLLVRRPNGCELTAEGEIFLSAAERMETEMLAAQSQIGRIDTAIAGTVRIGAPDGFGVS
FT                   FLAPRLGRLTARHPELKLQLVPVPRSFSLSQREADIAITIERPEQGRLVSSKLTDYTLG
FT                   LYASADYLARYGTPRTIDDLKNHRRIGYVEDLIFTPSLNFSAEIMRSWDASFEISSATG
FT                   QTEAVRSSAGVGILHNYIARHYPELTRLLPDTTIRRAYWTTYHESARELVRVRTVVSFL
FT                   QELLTAEHQIFV"
     MDWDDVRVFL AVARTGQILA ASKRLGINHA TLSRRVTALE ETLKTRLLVR RPNGCELTAE        60
     GEIFLSAAER METEMLAAQS QIGRIDTAIA GTVRIGAPDG FGVSFLAPRL GRLTARHPEL       120
     KLQLVPVPRS FSLSQREADI AITIERPEQG RLVSSKLTDY TLGLYASADY LARYGTPRTI       180
     DDLKNHRRIG YVEDLIFTPS LNFSAEIMRS WDASFEISSA TGQTEAVRSS AGVGILHNYI       240
     ARHYPELTRL LPDTTIRRAY WTTYHESARE LVRVRTVVSF LQELLTAEHQ IFV              293
//

If you have problems or comments...

PBIL Back to PBIL home page