(data stored in ACNUC7421 zone)

EMBL: CP001389.PE333

CP001389.PE333       Location/Qualifiers
FT   CDS             387858..388292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03400"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-12a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24137"
FT                   /db_xref="GOA:C3MBV6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MBV6"
FT                   /protein_id="ACP24137.1"
FT                   /translation="MDERSQSHATWDCKYHVVFSSKYRTKRLYGDLRRELGDLLHRLAL
FT                   QKDCRIEEGHLMPDHVHMLISIPPKYSVSHIVGFLKGKTALYVANKYARKRRYKGYHFW
FT                   ARGYFVSTAGYDEQVVRRYIRNQEKADKASDFADLFNRSY"
     MDERSQSHAT WDCKYHVVFS SKYRTKRLYG DLRRELGDLL HRLALQKDCR IEEGHLMPDH        60
     VHMLISIPPK YSVSHIVGFL KGKTALYVAN KYARKRRYKG YHFWARGYFV STAGYDEQVV       120
     RRYIRNQEKA DKASDFADLF NRSY                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page